Clone BO26147 Report

Search the DGRC for BO26147

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptSfp87B-RA
Protein status:BO26147.pep: Imported from assembly
Sequenced Size:295

Clone Sequence Records

BO26147.complete Sequence

295 bp assembled on 2010-06-29

GenBank Submission: KX796893

> BO26147.complete
GAAGTTATCAGTCGACATGCGTTTCGTATTTGTATTCGTCCTGTTATCGG
TCCTGGCTCTCAGTCTGGTTTCCGCCAAGGAACAATCAAAAACTAGCTCA
TCGCCAGGAAGGAACAATGTCGGAGCCACAGTAAACCCTCGATTGCGTCC
CAAGCGTAATATATTGTTCAATAGGCCCACCATTCGTGGTCAAGTGCAAC
GCTATATCTATGGTTATCCCTATCATAATGGGGTTCCTACGTACTACAAA
TACCCGTACTACGGCTACTTCAGGATCGCAAGCTTTCTAGACCAT

BO26147.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-RA 264 CG42485-PA 1..261 17..277 1305 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-RA 396 CG42485-RA 48..315 10..277 1310 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12273173..12273440 10..277 1310 99.3 Plus
Blast to na_te.dros performed on 2014-11-26 14:30:51 has no hits.

BO26147.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:22 Download gff for BO26147.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 55..315 17..279 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:36:11 Download gff for BO26147.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 55..315 17..279 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:29 Download gff for BO26147.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp87B-RA 55..315 17..279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:29 Download gff for BO26147.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12273180..12273440 17..279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:36:11 Download gff for BO26147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8098902..8099162 17..279 99   Plus

BO26147.pep Sequence

Translation from 16 to 295

> BO26147.pep
MRFVFVFVLLSVLALSLVSAKEQSKTSSSPGRNNVGATVNPRLRPKRNIL
FNRPTIRGQVQRYIYGYPYHNGVPTYYKYPYYGYFRIASFLDH

BO26147.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:35:08
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp87B-PA 87 CG42485-PA 1..87 1..87 459 100 Plus