Clone BO26156 Report

Search the DGRC for BO26156

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG34310-RA
Protein status:BO26156.pep: Imported from assembly
Sequenced Size:256

Clone Sequence Records

BO26156.complete Sequence

256 bp assembled on 2010-07-02

GenBank Submission: KX798455

> BO26156.complete
GAAGTTATCAGTCGACATGAGTTTCATTAACGGCTTCAAAAGATTCGCCA
CAACGACGGTTGGTCTGATGGCCATCGGTATTGGATCGACTGTTATATTC
TACACCACCCATCGCCTTGTCATCAAACCCTATCTTCTCGAGAAACGACG
CCTGGAAGCCGAGGCCAGTGCGGAGTACCTCTTCCAGCAGGAGGTTCACT
CCCAGATTGGCGAGTCAAGACCCAAACGGAGCGAATATGCAAGCTTTCTA
GACCAT

BO26156.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34310-RD 225 CG34310-PD 1..222 17..238 1110 100 Plus
CG34310-RA 225 CG34310-PA 1..222 17..238 1110 100 Plus
CG34310-RC 225 CG34310-PC 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34310-RD 4306 CG34310-RD 3827..4048 17..238 1110 100 Plus
CG34310-RA 706 CG34310-RA 266..487 17..238 1110 100 Plus
CG34310-RC 4002 CG34310-RC 3523..3744 17..238 1110 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6674301..6674522 17..238 1110 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:24:26 has no hits.

BO26156.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 15:54:46 Download gff for BO26156.complete
Subject Subject Range Query Range Percent Splice Strand
cup-RB 3526..3747 17..240 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:39 Download gff for BO26156.complete
Subject Subject Range Query Range Percent Splice Strand
cup-RB 3523..3744 17..240 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:28:37 Download gff for BO26156.complete
Subject Subject Range Query Range Percent Splice Strand
CG34310-RC 3523..3744 17..240 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:28:37 Download gff for BO26156.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6674301..6674522 17..240 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:39 Download gff for BO26156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6674301..6674522 17..240 99   Plus

BO26156.pep Sequence

Translation from 16 to 256

> BO26156.pep
MSFINGFKRFATTTVGLMAIGIGSTVIFYTTHRLVIKPYLLEKRRLEAEA
SAEYLFQQEVHSQIGESRPKRSEYASFLDH

BO26156.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34310-PD 74 CG34310-PD 1..74 1..74 372 100 Plus
CG34310-PA 74 CG34310-PA 1..74 1..74 372 100 Plus
CG34310-PC 74 CG34310-PC 1..74 1..74 372 100 Plus