BO26156.complete Sequence
256 bp assembled on 2010-07-02
GenBank Submission: KX798455
> BO26156.complete
GAAGTTATCAGTCGACATGAGTTTCATTAACGGCTTCAAAAGATTCGCCA
CAACGACGGTTGGTCTGATGGCCATCGGTATTGGATCGACTGTTATATTC
TACACCACCCATCGCCTTGTCATCAAACCCTATCTTCTCGAGAAACGACG
CCTGGAAGCCGAGGCCAGTGCGGAGTACCTCTTCCAGCAGGAGGTTCACT
CCCAGATTGGCGAGTCAAGACCCAAACGGAGCGAATATGCAAGCTTTCTA
GACCAT
BO26156.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:24:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-RD | 225 | CG34310-PD | 1..222 | 17..238 | 1110 | 100 | Plus |
CG34310-RA | 225 | CG34310-PA | 1..222 | 17..238 | 1110 | 100 | Plus |
CG34310-RC | 225 | CG34310-PC | 1..222 | 17..238 | 1110 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:24:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-RD | 4306 | CG34310-RD | 3827..4048 | 17..238 | 1110 | 100 | Plus |
CG34310-RA | 706 | CG34310-RA | 266..487 | 17..238 | 1110 | 100 | Plus |
CG34310-RC | 4002 | CG34310-RC | 3523..3744 | 17..238 | 1110 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:24:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6674301..6674522 | 17..238 | 1110 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:24:26 has no hits.
BO26156.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 15:54:46 Download gff for
BO26156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cup-RB | 3526..3747 | 17..240 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:18:39 Download gff for
BO26156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cup-RB | 3523..3744 | 17..240 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:28:37 Download gff for
BO26156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34310-RC | 3523..3744 | 17..240 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:28:37 Download gff for
BO26156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6674301..6674522 | 17..240 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:18:39 Download gff for
BO26156.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6674301..6674522 | 17..240 | 99 | | Plus |
BO26156.pep Sequence
Translation from 16 to 256
> BO26156.pep
MSFINGFKRFATTTVGLMAIGIGSTVIFYTTHRLVIKPYLLEKRRLEAEA
SAEYLFQQEVHSQIGESRPKRSEYASFLDH
BO26156.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:37:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34310-PD | 74 | CG34310-PD | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PA | 74 | CG34310-PA | 1..74 | 1..74 | 372 | 100 | Plus |
CG34310-PC | 74 | CG34310-PC | 1..74 | 1..74 | 372 | 100 | Plus |