Clone BO26160 Report

Search the DGRC for BO26160

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptRpL29-RA
Protein status:BO26160.pep: Imported from assembly
Sequenced Size:262

Clone Sequence Records

BO26160.complete Sequence

262 bp assembled on 2010-06-29

GenBank Submission: KX797618

> BO26160.complete
GAAGTTATCAGTCGACATGGCCAAGTCCAAGAACCACACAAATCACAACC
AGAACAAGAAGGCCCATCGTAATGGCATCAAGCGCCCGCTGCGCAAACGC
CACGAGTCCACTCTGGGTATGGATGTGAAATTCCTGATCAACCAGCGCTA
CGCACGCAAGGGAAACCTTTCCCGCGAGGAGTCCGTGAAGCGCTACAACG
AGCGCATCGCTTCCCAGAAGGGCAAGCCAAAGCCTGTTACTCTGGCAAGC
TTTCTAGACCAT

BO26160.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
RpL29-RD 231 CG10071-PD 1..228 17..244 1125 99.6 Plus
RpL29-RB 231 CG10071-PB 1..228 17..244 1125 99.6 Plus
RpL29-RA 231 CG10071-PA 1..228 17..244 1125 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
RpL29-RD 304 CG10071-RD 29..256 17..244 1125 99.6 Plus
RpL29-RB 389 CG10071-RB 114..341 17..244 1125 99.6 Plus
RpL29-RA 329 CG10071-RA 54..281 17..244 1125 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21294231..21294356 119..244 615 99.2 Plus
2R 25286936 2R 21294060..21294161 17..118 510 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:08:17 has no hits.

BO26160.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:16 Download gff for BO26160.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RB 99..326 17..246 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:01 Download gff for BO26160.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RA 54..281 17..246 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:18 Download gff for BO26160.complete
Subject Subject Range Query Range Percent Splice Strand
RpL29-RA 54..281 17..246 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:18 Download gff for BO26160.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21294060..21294161 17..118 100 -> Plus
2R 21294231..21294356 119..246 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:01 Download gff for BO26160.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17181565..17181666 17..118 100 -> Plus
arm_2R 17181736..17181861 119..246 97   Plus

BO26160.pep Sequence

Translation from 16 to 262

> BO26160.pep
MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGN
LSREESVKRYNERIASQKGKPKPVTLASFLDH

BO26160.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpL29-PD 76 CG10071-PD 1..76 1..76 396 100 Plus
RpL29-PB 76 CG10071-PB 1..76 1..76 396 100 Plus
RpL29-PA 76 CG10071-PA 1..76 1..76 396 100 Plus