BO26160.complete Sequence
262 bp assembled on 2010-06-29
GenBank Submission: KX797618
> BO26160.complete
GAAGTTATCAGTCGACATGGCCAAGTCCAAGAACCACACAAATCACAACC
AGAACAAGAAGGCCCATCGTAATGGCATCAAGCGCCCGCTGCGCAAACGC
CACGAGTCCACTCTGGGTATGGATGTGAAATTCCTGATCAACCAGCGCTA
CGCACGCAAGGGAAACCTTTCCCGCGAGGAGTCCGTGAAGCGCTACAACG
AGCGCATCGCTTCCCAGAAGGGCAAGCCAAAGCCTGTTACTCTGGCAAGC
TTTCTAGACCAT
BO26160.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:08:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL29-RD | 231 | CG10071-PD | 1..228 | 17..244 | 1125 | 99.6 | Plus |
RpL29-RB | 231 | CG10071-PB | 1..228 | 17..244 | 1125 | 99.6 | Plus |
RpL29-RA | 231 | CG10071-PA | 1..228 | 17..244 | 1125 | 99.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:08:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL29-RD | 304 | CG10071-RD | 29..256 | 17..244 | 1125 | 99.6 | Plus |
RpL29-RB | 389 | CG10071-RB | 114..341 | 17..244 | 1125 | 99.6 | Plus |
RpL29-RA | 329 | CG10071-RA | 54..281 | 17..244 | 1125 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:08:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 21294231..21294356 | 119..244 | 615 | 99.2 | Plus |
2R | 25286936 | 2R | 21294060..21294161 | 17..118 | 510 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 01:08:17 has no hits.
BO26160.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:16 Download gff for
BO26160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL29-RB | 99..326 | 17..246 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:46:01 Download gff for
BO26160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL29-RA | 54..281 | 17..246 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:19:18 Download gff for
BO26160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL29-RA | 54..281 | 17..246 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:19:18 Download gff for
BO26160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 21294060..21294161 | 17..118 | 100 | -> | Plus |
2R | 21294231..21294356 | 119..246 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:46:01 Download gff for
BO26160.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 17181565..17181666 | 17..118 | 100 | -> | Plus |
arm_2R | 17181736..17181861 | 119..246 | 97 | | Plus |
BO26160.pep Sequence
Translation from 16 to 262
> BO26160.pep
MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGN
LSREESVKRYNERIASQKGKPKPVTLASFLDH
BO26160.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:37:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL29-PD | 76 | CG10071-PD | 1..76 | 1..76 | 396 | 100 | Plus |
RpL29-PB | 76 | CG10071-PB | 1..76 | 1..76 | 396 | 100 | Plus |
RpL29-PA | 76 | CG10071-PA | 1..76 | 1..76 | 396 | 100 | Plus |