Clone BO26161 Report

Search the DGRC for BO26161

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG33714-RA
Protein status:BO26161.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO26161.complete Sequence

304 bp assembled on 2010-06-29

GenBank Submission: KX799679

> BO26161.complete
GAAGTTATCAGTCGACATGGCCACCGCCGCAGCTGTAGCAAAAGTCGGAA
AATCAGTGCACCGCATTTTCGTGGGCAATCTACCGTGGACAGTGGGCCAC
CAGGAGTTGCGTGGCTACTTCCGCGAGTTCGGACGCGTGGTGTCCGCCAA
CGTGATCTTCGACAAGCGAACGGGGTGCTCGAAGGGCTACGGTTTCGTTA
GCTTCAACAGTTTGACCGCGCTGGAGAAGATCGAGAACGAGCAGAAGCAC
ATACTGGAGGGCAACTACCTAAACATACAGAAATCTGCAAGCTTTCTAGA
CCAT

BO26161.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:29:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG33714-RB 273 CG33714-PB 1..270 17..286 1350 100 Plus
CG33714-RA 273 CG33714-PA 1..270 17..286 1350 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG33714-RB 1279 CG33714-RB 87..357 16..286 1355 100 Plus
CG33714-RA 1278 CG33714-RA 86..356 16..286 1355 100 Plus
CG33713-RB 1278 CG33713-RB 86..356 16..286 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:29:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21318858..21319128 286..16 1355 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:29:55 has no hits.

BO26161.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:08 Download gff for BO26161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33713-RB 87..356 17..288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:46 Download gff for BO26161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33713-RB 87..356 17..288 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:01 Download gff for BO26161.complete
Subject Subject Range Query Range Percent Splice Strand
CG33713-RB 87..356 17..288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:01 Download gff for BO26161.complete
Subject Subject Range Query Range Percent Splice Strand
X 21318856..21319127 17..288 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:46 Download gff for BO26161.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21189883..21190154 17..288 99   Minus

BO26161.pep Sequence

Translation from 16 to 304

> BO26161.pep
MATAAAVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDK
RTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKSASFLDH

BO26161.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG33714-PB 90 CG33714-PB 1..90 1..90 466 100 Plus
CG33714-PA 90 CG33714-PA 1..90 1..90 466 100 Plus
CG8021-PA 91 CG8021-PA 7..85 12..90 213 45.6 Plus
Hrb98DE-PE 360 CG9983-PE 113..192 11..90 156 33.8 Plus
Hrb98DE-PF 361 CG9983-PF 114..193 11..90 156 33.8 Plus