BO26161.complete Sequence
304 bp assembled on 2010-06-29
GenBank Submission: KX799679
> BO26161.complete
GAAGTTATCAGTCGACATGGCCACCGCCGCAGCTGTAGCAAAAGTCGGAA
AATCAGTGCACCGCATTTTCGTGGGCAATCTACCGTGGACAGTGGGCCAC
CAGGAGTTGCGTGGCTACTTCCGCGAGTTCGGACGCGTGGTGTCCGCCAA
CGTGATCTTCGACAAGCGAACGGGGTGCTCGAAGGGCTACGGTTTCGTTA
GCTTCAACAGTTTGACCGCGCTGGAGAAGATCGAGAACGAGCAGAAGCAC
ATACTGGAGGGCAACTACCTAAACATACAGAAATCTGCAAGCTTTCTAGA
CCAT
BO26161.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:29:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33714-RB | 273 | CG33714-PB | 1..270 | 17..286 | 1350 | 100 | Plus |
CG33714-RA | 273 | CG33714-PA | 1..270 | 17..286 | 1350 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:29:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33714-RB | 1279 | CG33714-RB | 87..357 | 16..286 | 1355 | 100 | Plus |
CG33714-RA | 1278 | CG33714-RA | 86..356 | 16..286 | 1355 | 100 | Plus |
CG33713-RB | 1278 | CG33713-RB | 86..356 | 16..286 | 1355 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:29:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 21318858..21319128 | 286..16 | 1355 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:29:55 has no hits.
BO26161.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:08 Download gff for
BO26161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33713-RB | 87..356 | 17..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:46 Download gff for
BO26161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33713-RB | 87..356 | 17..288 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:54:01 Download gff for
BO26161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33713-RB | 87..356 | 17..288 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:54:01 Download gff for
BO26161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 21318856..21319127 | 17..288 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:46 Download gff for
BO26161.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 21189883..21190154 | 17..288 | 99 | | Minus |
BO26161.pep Sequence
Translation from 16 to 304
> BO26161.pep
MATAAAVAKVGKSVHRIFVGNLPWTVGHQELRGYFREFGRVVSANVIFDK
RTGCSKGYGFVSFNSLTALEKIENEQKHILEGNYLNIQKSASFLDH
BO26161.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:40:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33714-PB | 90 | CG33714-PB | 1..90 | 1..90 | 466 | 100 | Plus |
CG33714-PA | 90 | CG33714-PA | 1..90 | 1..90 | 466 | 100 | Plus |
CG8021-PA | 91 | CG8021-PA | 7..85 | 12..90 | 213 | 45.6 | Plus |
Hrb98DE-PE | 360 | CG9983-PE | 113..192 | 11..90 | 156 | 33.8 | Plus |
Hrb98DE-PF | 361 | CG9983-PF | 114..193 | 11..90 | 156 | 33.8 | Plus |