Clone BO26163 Report

Search the DGRC for BO26163

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:63
Vector:pDNR-Dual
Associated Gene/Transcriptox-RA
Protein status:BO26163.pep: Inserted from web
Sequenced Size:199

Clone Sequence Records

BO26163.complete Sequence

199 bp assembled on 2010-07-02

GenBank Submission: KX796509

> BO26163.complete
GAAGTTATCAGTCGACATGAAGGTTATCTACAACACCCTGTTCAAGCGCA
CCTCCACCTACGCCGTGGCCATCATCGCGTCGGCCTTTTTCTTCGAGCGC
GCTCTCGATGTCACGTCGGTTGCGATTTTCGAGGGCATCAACAAAGGCAA
ACTCTGGAAGGACATCAAGGGCAAATACGAAGCAAGCTTTCTAGACCAT

BO26163.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
ox-RA 168 CG8764-PA 1..165 17..181 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
ox-RA 331 CG8764-RA 99..265 15..181 835 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:27:21
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12757298..12757431 148..15 670 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:27:22 has no hits.

BO26163.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:05 Download gff for BO26163.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 95..259 17..183 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:15:33 Download gff for BO26163.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 101..265 17..183 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:57 Download gff for BO26163.complete
Subject Subject Range Query Range Percent Splice Strand
ox-RA 101..265 17..183 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:57 Download gff for BO26163.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12757197..12757231 149..183 94 <- Minus
2R 12757298..12757429 17..148 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:15:33 Download gff for BO26163.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8644702..8644736 149..183 94 <- Minus
arm_2R 8644803..8644934 17..148 100   Minus

BO26163.pep Sequence

Translation from 16 to 199

> BO26163.pep
MKVIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDI
KGKYEASFLDH

BO26163.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
ox-PA 55 CG8764-PA 1..55 1..55 277 100 Plus