BO26163.complete Sequence
199 bp assembled on 2010-07-02
GenBank Submission: KX796509
> BO26163.complete
GAAGTTATCAGTCGACATGAAGGTTATCTACAACACCCTGTTCAAGCGCA
CCTCCACCTACGCCGTGGCCATCATCGCGTCGGCCTTTTTCTTCGAGCGC
GCTCTCGATGTCACGTCGGTTGCGATTTTCGAGGGCATCAACAAAGGCAA
ACTCTGGAAGGACATCAAGGGCAAATACGAAGCAAGCTTTCTAGACCAT
BO26163.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:27:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ox-RA | 168 | CG8764-PA | 1..165 | 17..181 | 825 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:27:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ox-RA | 331 | CG8764-RA | 99..265 | 15..181 | 835 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:27:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12757298..12757431 | 148..15 | 670 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:27:22 has no hits.
BO26163.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:05 Download gff for
BO26163.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ox-RA | 95..259 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:15:33 Download gff for
BO26163.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ox-RA | 101..265 | 17..183 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:10:57 Download gff for
BO26163.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ox-RA | 101..265 | 17..183 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:10:57 Download gff for
BO26163.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12757197..12757231 | 149..183 | 94 | <- | Minus |
2R | 12757298..12757429 | 17..148 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:15:33 Download gff for
BO26163.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8644702..8644736 | 149..183 | 94 | <- | Minus |
arm_2R | 8644803..8644934 | 17..148 | 100 | | Minus |
BO26163.pep Sequence
Translation from 16 to 199
> BO26163.pep
MKVIYNTLFKRTSTYAVAIIASAFFFERALDVTSVAIFEGINKGKLWKDI
KGKYEASFLDH
BO26163.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:37:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ox-PA | 55 | CG8764-PA | 1..55 | 1..55 | 277 | 100 | Plus |