Clone BO26164 Report

Search the DGRC for BO26164

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG18624-RA
Protein status:BO26164.pep: Imported from assembly
Sequenced Size:202

Clone Sequence Records

BO26164.complete Sequence

202 bp assembled on 2010-06-29

GenBank Submission: KX796882

> BO26164.complete
GAAGTTATCAGTCGACATGGTCTTGGGACTGGATAAGCGAGCACTGTGGG
GCGCGTTGCCCCTGCTGGGATTTGCCATTGGCCACTTCCTGGACAAGAAG
GAAACGGAACGTATGACCATGTTCCGGGACAAGAGTGCCCTATACGGCCG
TCCCGCCGGCAGCGAGGGTAAGGCGCCATCCTGGGCAAGCTTTCTAGACC
AT

BO26164.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-RD 171 CG18624-PD 1..168 17..184 840 100 Plus
CG18624-RC 171 CG18624-PC 1..168 17..184 840 100 Plus
CG18624-RE 171 CG18624-PE 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:29:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-RD 649 CG18624-RD 401..569 16..184 845 100 Plus
CG18624-RC 413 CG18624-RC 165..333 16..184 845 100 Plus
CG18624-RE 575 CG18624-RE 327..495 16..184 845 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:29:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7893133..7893301 184..16 845 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:29:41 has no hits.

BO26164.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:06 Download gff for BO26164.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RB 262..429 17..186 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:40 Download gff for BO26164.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RE 328..495 17..186 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:56 Download gff for BO26164.complete
Subject Subject Range Query Range Percent Splice Strand
CG18624-RE 328..495 17..186 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:56 Download gff for BO26164.complete
Subject Subject Range Query Range Percent Splice Strand
X 7893131..7893300 17..186 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:40 Download gff for BO26164.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7787164..7787333 17..186 98   Minus

BO26164.pep Sequence

Translation from 16 to 202

> BO26164.pep
MVLGLDKRALWGALPLLGFAIGHFLDKKETERMTMFRDKSALYGRPAGSE
GKAPSWASFLDH

BO26164.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG18624-PD 56 CG18624-PD 1..56 1..56 297 100 Plus
CG18624-PC 56 CG18624-PC 1..56 1..56 297 100 Plus
CG18624-PE 56 CG18624-PE 1..56 1..56 297 100 Plus
CG18624-PB 56 CG18624-PB 1..56 1..56 297 100 Plus
CG18624-PA 56 CG18624-PA 1..56 1..56 297 100 Plus