Clone BO26166 Report

Search the DGRC for BO26166

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG9603-RA
Protein status:BO26166.pep: Imported from assembly
Sequenced Size:301

Clone Sequence Records

BO26166.complete Sequence

301 bp assembled on 2010-06-29

GenBank Submission: KX793898

> BO26166.complete
GAAGTTATCAGTCGACATGATGAACCTGTCGAGAGCTGTTGTCCGTAGCT
TCGCTACCACCGCTGGCCGCCGGTCCGCCGCCGTGCCCAAGGACCAGATC
GAGAAGGGATACTTCGAGATCCGCAAGGTGCAGGAGCACTTTCAGAAGAA
GGACGGCAAGCCCGTCTTCCTCAAGGGATCCGTCGTGGACAACGTGCTCT
ACCGCGTCACCGTCGCTCTCGCCCTCGTCGGCATCGGTGGCATGGGCAAG
CTTTTCTACGAGCTGAGTGTTCCCAAGAAGGAGGCAAGCTTTCTAGACCA
T

BO26166.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-RA 270 CG9603-PA 1..267 17..283 1335 100 Plus
CG9603-RB 297 CG9603-PB 46..294 35..283 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-RA 621 CG9603-RA 114..380 17..283 1335 100 Plus
CG9603-RB 566 CG9603-RB 77..325 35..283 1245 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8340523..8340771 283..35 1245 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:29:28 has no hits.

BO26166.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:04 Download gff for BO26166.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 112..378 17..285 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:35 Download gff for BO26166.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 114..380 17..285 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:51 Download gff for BO26166.complete
Subject Subject Range Query Range Percent Splice Strand
CG9603-RA 114..380 17..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:51 Download gff for BO26166.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8340520..8340771 35..285 99 <- Minus
3R 8340913..8340930 17..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:35 Download gff for BO26166.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4166242..4166493 35..285 99 <- Minus
arm_3R 4166635..4166652 17..34 100   Minus

BO26166.pep Sequence

Translation from 16 to 301

> BO26166.pep
MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPV
FLKGSVVDNVLYRVTVALALVGIGGMGKLFYELSVPKKEASFLDH

BO26166.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG9603-PA 89 CG9603-PA 1..89 1..89 444 100 Plus
CG9603-PB 98 CG9603-PB 16..98 7..89 415 100 Plus