BO26167.complete Sequence
190 bp assembled on 2010-06-29
GenBank Submission: KX797817
> BO26167.complete
GAAGTTATCAGTCGACATGGTAAAGTCTTCAAATCCCCTGAGCATCGTGC
GCAGCATTTACAACAACGAATTTCAATGGATGCTGGTCAAGAGCTACGGA
CTTTTCTTCTTGGGAGTGCGTTTGGCCAAGGAGTTCGTGGGTGTCGAACT
GATGCCGTCGCTGGGGCCAGCCGCAAGCTTTCTAGACCAT
BO26167.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:29:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34200-RA | 159 | CG34200-PA | 1..156 | 17..172 | 765 | 99.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:29:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34200-RA | 321 | CG34200-RA | 103..258 | 17..172 | 765 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:29:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 5757910..5758004 | 78..172 | 475 | 100 | Plus |
2R | 25286936 | 2R | 5757764..5757826 | 17..79 | 300 | 98.4 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:29:19 has no hits.
BO26167.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:03 Download gff for
BO26167.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34200-RA | 72..227 | 17..174 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:31 Download gff for
BO26167.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34200-RA | 103..258 | 17..174 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:48 Download gff for
BO26167.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34200-RA | 103..258 | 17..174 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:48 Download gff for
BO26167.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 5757764..5757825 | 17..78 | 98 | -> | Plus |
2R | 5757911..5758004 | 79..174 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:31 Download gff for
BO26167.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 1645269..1645330 | 17..78 | 98 | -> | Plus |
arm_2R | 1645416..1645509 | 79..174 | 97 | | Plus |
BO26167.pep Sequence
Translation from 16 to 190
> BO26167.pep
MVKSSNPLSIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPSLG
PAASFLDH
BO26167.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34200-PA | 52 | CG34200-PA | 1..52 | 1..52 | 264 | 100 | Plus |