Clone BO26167 Report

Search the DGRC for BO26167

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:67
Vector:pDNR-Dual
Associated Gene/TranscriptCG34200-RA
Protein status:BO26167.pep: Inserted from web
Sequenced Size:190

Clone Sequence Records

BO26167.complete Sequence

190 bp assembled on 2010-06-29

GenBank Submission: KX797817

> BO26167.complete
GAAGTTATCAGTCGACATGGTAAAGTCTTCAAATCCCCTGAGCATCGTGC
GCAGCATTTACAACAACGAATTTCAATGGATGCTGGTCAAGAGCTACGGA
CTTTTCTTCTTGGGAGTGCGTTTGGCCAAGGAGTTCGTGGGTGTCGAACT
GATGCCGTCGCTGGGGCCAGCCGCAAGCTTTCTAGACCAT

BO26167.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-RA 159 CG34200-PA 1..156 17..172 765 99.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-RA 321 CG34200-RA 103..258 17..172 765 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5757910..5758004 78..172 475 100 Plus
2R 25286936 2R 5757764..5757826 17..79 300 98.4 Plus
Blast to na_te.dros performed on 2014-11-26 14:29:19 has no hits.

BO26167.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:03 Download gff for BO26167.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 72..227 17..174 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:31 Download gff for BO26167.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 103..258 17..174 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:48 Download gff for BO26167.complete
Subject Subject Range Query Range Percent Splice Strand
CG34200-RA 103..258 17..174 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:48 Download gff for BO26167.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5757764..5757825 17..78 98 -> Plus
2R 5757911..5758004 79..174 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:31 Download gff for BO26167.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1645269..1645330 17..78 98 -> Plus
arm_2R 1645416..1645509 79..174 97   Plus

BO26167.pep Sequence

Translation from 16 to 190

> BO26167.pep
MVKSSNPLSIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPSLG
PAASFLDH

BO26167.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG34200-PA 52 CG34200-PA 1..52 1..52 264 100 Plus