Clone BO26168 Report

Search the DGRC for BO26168

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG34117-RA
Protein status:BO26168.pep: Inserted from web
Sequenced Size:337

Clone Sequence Records

BO26168.complete Sequence

337 bp assembled on 2010-06-29

GenBank Submission: KX794734

> BO26168.complete
GAAGTTATCAGTCGACATGGCGGGAACCAAGGTGCTGCGCTCCCTGCTGC
ACGAATTGCGCCAGGCATCTCCAAATGGCTGCATCAAGGACTCTCTGGCC
GCGCGCTACATTTTGGCGCAATACAAGAAGTTCGCCACCACGGAGCAACA
ATTCTGCAAGGCGCGCAACGAAGCGACTTTCCTGGGTCAAACCTACCTGA
CCTACCTAGCCAGCCAGCGCCGGTACTTGGAGCTCTACAAGGAATATCAC
GGAAGGGGCGAGAGATCCGTAAGGGATACCGCCGATTTGGTGGGCTTCAA
GCTGCCCTCGGATCCCAAGGCAAGCTTTCTAGACCAT

BO26168.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-RA 306 CG34117-PA 1..303 17..319 1500 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-RA 428 CG34117-RA 59..361 17..319 1500 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9399637..9399939 319..17 1500 99.7 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:23 has no hits.

BO26168.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:55 Download gff for BO26168.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 55..357 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:31 Download gff for BO26168.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 59..361 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:04 Download gff for BO26168.complete
Subject Subject Range Query Range Percent Splice Strand
CG34117-RA 59..361 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:04 Download gff for BO26168.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9399634..9399939 17..321 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:31 Download gff for BO26168.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5225356..5225661 17..321 99   Minus

BO26168.pep Sequence

Translation from 16 to 337

> BO26168.pep
MAGTKVLRSLLHELRQASPNGCIKDSLAARYILAQYKKFATTEQQFCKAR
NEATFLGQTYLTYLASQRRYLELYKEYHGRGERSVRDTADLVGFKLPSDP
KASFLDH

BO26168.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34117-PA 101 CG34117-PA 1..101 1..101 521 100 Plus