Clone BO26173 Report

Search the DGRC for BO26173

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptAkh-RA
Protein status:BO26173.pep: Inserted from web
Sequenced Size:271

Clone Sequence Records

BO26173.complete Sequence

271 bp assembled on 2010-06-29

GenBank Submission: KX795402

> BO26173.complete
GAAGTTATCAGTCGACATGAATCCCAAGAGCGAAGTCCTCATTGCAGCCG
TGCTCTTCATGCTGCTGGCCTGCGTCCAGTGTCAATTGACCTTCTCGCCG
GATTGGGGCAAGCGTTCGGTGGGCGGAGCTGGTCCTGGAACCTTTTTCGA
GACACAGCAGGGCAACTGCAAGACCTCCAACGAAATGCTGCTCGAGATCT
TCCGCTTCGTGCAATCTCAGGCACAGCTCTTTCTGGACTGCAAGCACCGC
GAGGCAAGCTTTCTAGACCAT

BO26173.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-RA 240 CG1171-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-RA 536 CG1171-RA 120..356 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4141723..4141890 86..253 840 100 Plus
3L 28110227 3L 4141586..4141658 17..89 350 98.6 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:17 has no hits.

BO26173.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:55 Download gff for BO26173.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 1..237 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:29 Download gff for BO26173.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 120..356 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:02 Download gff for BO26173.complete
Subject Subject Range Query Range Percent Splice Strand
Akh-RA 120..356 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:02 Download gff for BO26173.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4141586..4141654 17..85 100 -> Plus
3L 4141723..4141890 86..255 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:29 Download gff for BO26173.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4141723..4141890 86..255 98   Plus
arm_3L 4141586..4141654 17..85 100 -> Plus

BO26173.pep Sequence

Translation from 16 to 271

> BO26173.pep
MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGN
CKTSNEMLLEIFRFVQSQAQLFLDCKHREASFLDH

BO26173.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:50:08
Subject Length Description Subject Range Query Range Score Percent Strand
Akh-PA 79 CG1171-PA 1..79 1..79 418 100 Plus