BO26173.complete Sequence
271 bp assembled on 2010-06-29
GenBank Submission: KX795402
> BO26173.complete
GAAGTTATCAGTCGACATGAATCCCAAGAGCGAAGTCCTCATTGCAGCCG
TGCTCTTCATGCTGCTGGCCTGCGTCCAGTGTCAATTGACCTTCTCGCCG
GATTGGGGCAAGCGTTCGGTGGGCGGAGCTGGTCCTGGAACCTTTTTCGA
GACACAGCAGGGCAACTGCAAGACCTCCAACGAAATGCTGCTCGAGATCT
TCCGCTTCGTGCAATCTCAGGCACAGCTCTTTCTGGACTGCAAGCACCGC
GAGGCAAGCTTTCTAGACCAT
BO26173.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Akh-RA | 240 | CG1171-PA | 1..237 | 17..253 | 1185 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Akh-RA | 536 | CG1171-RA | 120..356 | 17..253 | 1185 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 4141723..4141890 | 86..253 | 840 | 100 | Plus |
3L | 28110227 | 3L | 4141586..4141658 | 17..89 | 350 | 98.6 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:46:17 has no hits.
BO26173.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:55 Download gff for
BO26173.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Akh-RA | 1..237 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:29 Download gff for
BO26173.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Akh-RA | 120..356 | 17..255 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:02 Download gff for
BO26173.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Akh-RA | 120..356 | 17..255 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:02 Download gff for
BO26173.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 4141586..4141654 | 17..85 | 100 | -> | Plus |
3L | 4141723..4141890 | 86..255 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:29 Download gff for
BO26173.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 4141723..4141890 | 86..255 | 98 | | Plus |
arm_3L | 4141586..4141654 | 17..85 | 100 | -> | Plus |
BO26173.pep Sequence
Translation from 16 to 271
> BO26173.pep
MNPKSEVLIAAVLFMLLACVQCQLTFSPDWGKRSVGGAGPGTFFETQQGN
CKTSNEMLLEIFRFVQSQAQLFLDCKHREASFLDH
BO26173.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:50:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Akh-PA | 79 | CG1171-PA | 1..79 | 1..79 | 418 | 100 | Plus |