Clone BO26182 Report

Search the DGRC for BO26182

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:82
Vector:pDNR-Dual
Associated Gene/Transcriptksh-RB
Protein status:BO26182.pep: Inserted from web
Sequenced Size:250

Clone Sequence Records

BO26182.complete Sequence

250 bp assembled on 2010-07-02

GenBank Submission: KX795248

> BO26182.complete
GAAGTTATCAGTCGACATGAGCGCCCTGTTCAACTTCCACAGCCTGCTGT
CGGTCATCCTGCTGCTGATCTGCACCTGTGCCTACCTGCGCTCGCTCTTC
CCCAGCTTGATAGACCGCAACAAGACCGGATTCATGGGCACCTTCTGGAA
GCTGGCAAGGATTGGGGAGCGCAAGTCGCCGTGGGTAGGAGCCGCCTGCC
TGATCATGGCCTTCACCGTTCTCTTTTGGAGCGCAAGCTTTCTAGACCAT

BO26182.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:55:08
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-RB 219 CG14199-PB 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-RB 435 CG14199-RB 90..306 16..232 1085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:55:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19494727..19494837 129..19 555 100 Minus
X 23542271 X 19494549..19494652 232..129 520 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:55:07 has no hits.

BO26182.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:06 Download gff for BO26182.complete
Subject Subject Range Query Range Percent Splice Strand
CG14199-RB 77..292 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:56 Download gff for BO26182.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 91..306 17..234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:34:17 Download gff for BO26182.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 91..306 17..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:34:17 Download gff for BO26182.complete
Subject Subject Range Query Range Percent Splice Strand
X 19494546..19494651 130..234 98 <- Minus
X 19494727..19494838 17..129 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:56 Download gff for BO26182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19388579..19388684 130..234 98 <- Minus
arm_X 19388760..19388871 17..129 99   Minus

BO26182.pep Sequence

Translation from 16 to 250

> BO26182.pep
MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIG
ERKSPWVGAACLIMAFTVLFWSASFLDH

BO26182.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-PB 72 CG14199-PB 1..72 1..72 380 100 Plus