BO26182.complete Sequence
250 bp assembled on 2010-07-02
GenBank Submission: KX795248
> BO26182.complete
GAAGTTATCAGTCGACATGAGCGCCCTGTTCAACTTCCACAGCCTGCTGT
CGGTCATCCTGCTGCTGATCTGCACCTGTGCCTACCTGCGCTCGCTCTTC
CCCAGCTTGATAGACCGCAACAAGACCGGATTCATGGGCACCTTCTGGAA
GCTGGCAAGGATTGGGGAGCGCAAGTCGCCGTGGGTAGGAGCCGCCTGCC
TGATCATGGCCTTCACCGTTCTCTTTTGGAGCGCAAGCTTTCTAGACCAT
BO26182.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:55:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ksh-RB | 219 | CG14199-PB | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:55:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ksh-RB | 435 | CG14199-RB | 90..306 | 16..232 | 1085 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:55:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19494727..19494837 | 129..19 | 555 | 100 | Minus |
X | 23542271 | X | 19494549..19494652 | 232..129 | 520 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 01:55:07 has no hits.
BO26182.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:06 Download gff for
BO26182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14199-RB | 77..292 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:04:56 Download gff for
BO26182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ksh-RB | 91..306 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:34:17 Download gff for
BO26182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ksh-RB | 91..306 | 17..234 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:34:17 Download gff for
BO26182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19494546..19494651 | 130..234 | 98 | <- | Minus |
X | 19494727..19494838 | 17..129 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:04:56 Download gff for
BO26182.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 19388579..19388684 | 130..234 | 98 | <- | Minus |
arm_X | 19388760..19388871 | 17..129 | 99 | | Minus |
BO26182.pep Sequence
Translation from 16 to 250
> BO26182.pep
MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIG
ERKSPWVGAACLIMAFTVLFWSASFLDH
BO26182.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:37:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ksh-PB | 72 | CG14199-PB | 1..72 | 1..72 | 380 | 100 | Plus |