BO26183.complete Sequence
298 bp assembled on 2010-06-29
GenBank Submission: KX794779
> BO26183.complete
GAAGTTATCAGTCGACATGGATAAGCACGTGGCATTCATGGTCATCACCG
TTTTCTGGCTACTATTCGCCATCATTGGGTTCCTGGTGTCCTACCGATAC
GAGGAGCGTGGTCTAATCCGGTGCTGTGTGATCCTAACGGCTGTATGCTG
CTACTTGGCCTGGATGGTCACCTTCGTGATGCAGTTGAATCCACTGACCG
GACCGCGAGCCAAACAGAAGATTATCCTCGGCATGATAACCTACTGGCCC
AGGTCCATTATCCACGATGAAAAGGACCCAGCAAGCTTTCTAGACCAT
BO26183.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:28:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-d-RA | 267 | CG14909-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:28:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-d-RA | 494 | CG14909-RA | 15..278 | 17..280 | 1320 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:28:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 16975218..16975481 | 17..280 | 1320 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:28:43 has no hits.
BO26183.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:44:59 Download gff for
BO26183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14909-RA | 1..264 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:15 Download gff for
BO26183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-d-RA | 15..278 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:33 Download gff for
BO26183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
VhaM9.7-d-RA | 15..278 | 17..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:33 Download gff for
BO26183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 16975218..16975481 | 17..282 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:15 Download gff for
BO26183.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12800940..12801203 | 17..282 | 99 | | Plus |
BO26183.pep Sequence
Translation from 16 to 298
> BO26183.pep
MDKHVAFMVITVFWLLFAIIGFLVSYRYEERGLIRCCVILTAVCCYLAWM
VTFVMQLNPLTGPRAKQKIILGMITYWPRSIIHDEKDPASFLDH
BO26183.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:44:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
VhaM9.7-d-PA | 88 | CG14909-PA | 1..88 | 1..88 | 475 | 100 | Plus |
VhaM9.7-b-PB | 89 | CG7625-PB | 6..81 | 5..81 | 141 | 39.2 | Plus |
VhaM9.7-b-PA | 89 | CG7625-PA | 6..81 | 5..81 | 141 | 39.2 | Plus |
VhaM9.7-c-PA | 84 | CG11589-PA | 1..81 | 1..81 | 134 | 32.1 | Plus |
VhaM9.7-a-PC | 85 | CG1268-PC | 4..83 | 6..82 | 133 | 31.2 | Plus |