Clone BO26183 Report

Search the DGRC for BO26183

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptVhaM9.7-d-RA
Protein status:BO26183.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO26183.complete Sequence

298 bp assembled on 2010-06-29

GenBank Submission: KX794779

> BO26183.complete
GAAGTTATCAGTCGACATGGATAAGCACGTGGCATTCATGGTCATCACCG
TTTTCTGGCTACTATTCGCCATCATTGGGTTCCTGGTGTCCTACCGATAC
GAGGAGCGTGGTCTAATCCGGTGCTGTGTGATCCTAACGGCTGTATGCTG
CTACTTGGCCTGGATGGTCACCTTCGTGATGCAGTTGAATCCACTGACCG
GACCGCGAGCCAAACAGAAGATTATCCTCGGCATGATAACCTACTGGCCC
AGGTCCATTATCCACGATGAAAAGGACCCAGCAAGCTTTCTAGACCAT

BO26183.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-d-RA 267 CG14909-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-d-RA 494 CG14909-RA 15..278 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16975218..16975481 17..280 1320 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:28:43 has no hits.

BO26183.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:44:59 Download gff for BO26183.complete
Subject Subject Range Query Range Percent Splice Strand
CG14909-RA 1..264 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:15 Download gff for BO26183.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-d-RA 15..278 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:33 Download gff for BO26183.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-d-RA 15..278 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:33 Download gff for BO26183.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16975218..16975481 17..282 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:15 Download gff for BO26183.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12800940..12801203 17..282 99   Plus

BO26183.pep Sequence

Translation from 16 to 298

> BO26183.pep
MDKHVAFMVITVFWLLFAIIGFLVSYRYEERGLIRCCVILTAVCCYLAWM
VTFVMQLNPLTGPRAKQKIILGMITYWPRSIIHDEKDPASFLDH

BO26183.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-d-PA 88 CG14909-PA 1..88 1..88 475 100 Plus
VhaM9.7-b-PB 89 CG7625-PB 6..81 5..81 141 39.2 Plus
VhaM9.7-b-PA 89 CG7625-PA 6..81 5..81 141 39.2 Plus
VhaM9.7-c-PA 84 CG11589-PA 1..81 1..81 134 32.1 Plus
VhaM9.7-a-PC 85 CG1268-PC 4..83 6..82 133 31.2 Plus