Clone BO26184 Report

Search the DGRC for BO26184

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A3-RA
Protein status:BO26184.pep: Imported from assembly
Sequenced Size:331

Clone Sequence Records

BO26184.complete Sequence

331 bp assembled on 2010-06-29

GenBank Submission: KX799525

> BO26184.complete
GAAGTTATCAGTCGACATGCGATACCTGCCCTTTATCGCATTTTTCCTGT
TTGCTCTTCTGGCCCTGTCTGTGGGCGAGGAATTTTGCAATTGTAATCTT
ATCTATAGACCATTGTGCGCATCGAACTCCAAGACCTATAACAACTACTG
TGAATTCAAGTGTGAAGTTAAAAGGGGAAGCCCCATAACAGTGGTAAAAT
GGAAACAGTGCAATGAAAGTGCGGGGAAAATAAAGATAGATTGCCAATTG
CCTATAAACTTACAGTTGTGTAAAAGTATAAAATCTAATCGAAAAGATCC
AATCGCTATAGCTGCAAGCTTTCTAGACCAT

BO26184.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:28:40
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-RA 300 CG42474-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-RA 418 CG42474-RA 23..320 16..313 1490 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:28:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11839934..11840231 16..313 1490 100 Plus
Blast to na_te.dros performed 2014-11-26 14:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
accord 7404 accord ACCORD 7404bp 1376..1412 113..77 113 78.4 Minus

BO26184.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:44:56 Download gff for BO26184.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 24..320 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:35:13 Download gff for BO26184.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 24..320 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:53:31 Download gff for BO26184.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 24..320 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:53:31 Download gff for BO26184.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11839935..11840231 17..315 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:35:13 Download gff for BO26184.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11839935..11840231 17..315 99   Plus

BO26184.pep Sequence

Translation from 16 to 331

> BO26184.pep
MRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCEFKCE
VKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPIAIAA
SFLDH

BO26184.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-PA 99 CG42474-PA 1..99 1..99 533 100 Plus
CG31704-PB 68 CG31704-PB 1..68 1..65 153 50 Plus
CG31704-PA 68 CG31704-PA 1..68 1..65 153 50 Plus