Clone BO26188 Report

Search the DGRC for BO26188

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG31477-RA
Protein status:BO26188.pep: Imported from assembly
Sequenced Size:226

Clone Sequence Records

BO26188.complete Sequence

226 bp assembled on 2010-06-29

GenBank Submission: KX799070

> BO26188.complete
GAAGTTATCAGTCGACATGAAAGCCTGGAGAGATCTGGGTATTACCTATA
TCCAGTATTCCAACATCGCAGCCCGTGTGGTGCGAGAGGCCCTGCGCATT
GAGCTCCGTGCAGACGCCGCCAAGCGAAACATCAGCCATGTGAAGTTCAC
TCCGTGGGTGAACGGAAAGCCTGTGCCGCGCAAGAAGGTAGAACGTGAAT
CCGAATCTGCAAGCTTTCTAGACCAT

BO26188.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG31477-RC 195 CG31477-PC 1..192 17..208 960 100 Plus
CG31477-RB 195 CG31477-PB 1..192 17..208 960 100 Plus
CG31477-RA 195 CG31477-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG31477-RC 424 CG31477-RC 130..321 17..208 960 100 Plus
CG31477-RB 490 CG31477-RB 196..387 17..208 960 100 Plus
CG31477-RA 482 CG31477-RA 196..387 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10122026..10122217 17..208 960 100 Plus
Blast to na_te.dros performed on 2014-11-26 14:33:57 has no hits.

BO26188.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:50 Download gff for BO26188.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RB 166..357 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:27 Download gff for BO26188.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 196..387 17..210 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:36 Download gff for BO26188.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 196..387 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:36 Download gff for BO26188.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10122026..10122217 17..210 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:27 Download gff for BO26188.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5947748..5947939 17..210 98   Plus

BO26188.pep Sequence

Translation from 16 to 226

> BO26188.pep
MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNG
KPVPRKKVERESESASFLDH

BO26188.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG31477-PC 64 CG31477-PC 1..64 1..64 328 100 Plus
CG31477-PB 64 CG31477-PB 1..64 1..64 328 100 Plus
CG31477-PA 64 CG31477-PA 1..64 1..64 328 100 Plus
sun-PA 61 CG9032-PA 1..61 1..64 221 68.8 Plus
sun-PB 57 CG9032-PB 1..52 1..52 215 76.9 Plus