BO26188.complete Sequence
226 bp assembled on 2010-06-29
GenBank Submission: KX799070
> BO26188.complete
GAAGTTATCAGTCGACATGAAAGCCTGGAGAGATCTGGGTATTACCTATA
TCCAGTATTCCAACATCGCAGCCCGTGTGGTGCGAGAGGCCCTGCGCATT
GAGCTCCGTGCAGACGCCGCCAAGCGAAACATCAGCCATGTGAAGTTCAC
TCCGTGGGTGAACGGAAAGCCTGTGCCGCGCAAGAAGGTAGAACGTGAAT
CCGAATCTGCAAGCTTTCTAGACCAT
BO26188.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:33:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31477-RC | 195 | CG31477-PC | 1..192 | 17..208 | 960 | 100 | Plus |
CG31477-RB | 195 | CG31477-PB | 1..192 | 17..208 | 960 | 100 | Plus |
CG31477-RA | 195 | CG31477-PA | 1..192 | 17..208 | 960 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:33:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31477-RC | 424 | CG31477-RC | 130..321 | 17..208 | 960 | 100 | Plus |
CG31477-RB | 490 | CG31477-RB | 196..387 | 17..208 | 960 | 100 | Plus |
CG31477-RA | 482 | CG31477-RA | 196..387 | 17..208 | 960 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:33:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 10122026..10122217 | 17..208 | 960 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 14:33:57 has no hits.
BO26188.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:50 Download gff for
BO26188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31477-RB | 166..357 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:27 Download gff for
BO26188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31477-RA | 196..387 | 17..210 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:36 Download gff for
BO26188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31477-RA | 196..387 | 17..210 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:36 Download gff for
BO26188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 10122026..10122217 | 17..210 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:27 Download gff for
BO26188.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5947748..5947939 | 17..210 | 98 | | Plus |
BO26188.pep Sequence
Translation from 16 to 226
> BO26188.pep
MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNG
KPVPRKKVERESESASFLDH
BO26188.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:29:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31477-PC | 64 | CG31477-PC | 1..64 | 1..64 | 328 | 100 | Plus |
CG31477-PB | 64 | CG31477-PB | 1..64 | 1..64 | 328 | 100 | Plus |
CG31477-PA | 64 | CG31477-PA | 1..64 | 1..64 | 328 | 100 | Plus |
sun-PA | 61 | CG9032-PA | 1..61 | 1..64 | 221 | 68.8 | Plus |
sun-PB | 57 | CG9032-PB | 1..52 | 1..52 | 215 | 76.9 | Plus |