Clone BO26189 Report

Search the DGRC for BO26189

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptVhaM9.7-a-RA
Protein status:BO26189.pep: Inserted from web
Sequenced Size:289

Clone Sequence Records

BO26189.complete Sequence

289 bp assembled on 2010-06-29

GenBank Submission: KX794383

> BO26189.complete
GAAGTTATCAGTCGACATGGGTGCCGCTTTCTTTCCCGTGCTGTTTTTCA
CCGCCTTGTGGGGCGGTGTGGGCATCGCCATGCCCATAATGACCCCCAAA
GGACCTCACCAGAATCTGATCCGCTGCATCCTGATGCTGACCGCCGCCTG
CTGCTGGCTCTTCTGGCTATGTTGCTACATGGCCCAAATGAATCCCTTGA
TCGGGCCCAAACTAAAGCGCGATGTGGTGGCCATGATTGGAAGGTCCTGG
AACAACCCAATTGTGGCTGGTGCAAGCTTTCTAGACCAT

BO26189.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-RC 258 CG1268-PC 1..255 17..271 1275 100 Plus
VhaM9.7-a-RB 258 CG1268-PB 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-RC 710 CG1268-RC 60..314 17..271 1275 100 Plus
VhaM9.7-a-RB 471 CG1268-RB 52..306 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4262814..4263068 17..271 1275 100 Plus
Blast to na_te.dros performed 2014-11-26 14:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 8165..8210 133..178 113 71.7 Plus

BO26189.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:45:49 Download gff for BO26189.complete
Subject Subject Range Query Range Percent Splice Strand
CG1268-RC 63..317 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:23 Download gff for BO26189.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 52..306 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:33 Download gff for BO26189.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 52..306 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:33 Download gff for BO26189.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4262814..4263068 17..273 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:23 Download gff for BO26189.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4262814..4263068 17..273 99   Plus

BO26189.pep Sequence

Translation from 16 to 289

> BO26189.pep
MGAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAACCWLFW
LCCYMAQMNPLIGPKLKRDVVAMIGRSWNNPIVAGASFLDH

BO26189.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-PC 85 CG1268-PC 1..85 1..85 475 100 Plus
VhaM9.7-a-PB 85 CG1268-PB 1..85 1..85 475 100 Plus
VhaM9.7-c-PA 84 CG11589-PA 4..84 5..85 264 53.1 Plus
VhaM9.7-b-PB 89 CG7625-PB 9..81 9..82 226 50 Plus
VhaM9.7-b-PA 89 CG7625-PA 9..81 9..82 226 50 Plus