Clone BO26193 Report

Search the DGRC for BO26193

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:261
Well:93
Vector:pDNR-Dual
Associated Gene/TranscriptCG12825-RA
Protein status:BO26193.pep: Inserted from web
Sequenced Size:466

Clone Sequence Records

BO26193.complete Sequence

466 bp assembled on 2010-06-29

GenBank Submission: KX799639

> BO26193.complete
GAAGTTATCAGTCGACATGTGGAAGCTGGACACCAAAGGAGGAATCATCT
GCTCGGGCTGCCTGTCCATAGCCTTTGCCATAACCTATCTGGTTTTGATG
GACGATTACTTCTGGAAATATGGACTCTACGAGATGGGAATACACATTTC
GGCGCTGCAGATCTTGGGAAGCGTGGTCCTCATCGTTGGAGCCATAAAGC
AAAAGCACAAGTTCTTCGTGCCGTGGATGATAACCACAGGATTCTTTTTA
TACCTGATGGTGAACCTGTTCATTTCACTGATAGTCCAGGGCACAGCTTG
GATCTTCGGACCATTGATGGTCGTTCCGTTCACAGCCTATCTGGGCTGCG
CCCTGTACTCGGTGCAGAAGGCCTTCGACAGGATGCGCAAGGAGGAGCCA
CCGGCATATGCCAGCTTGTCCGACAAGAAGGAGTTCATCAATCACATAGC
AAGCTTTCTAGACCAT

BO26193.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-RA 435 CG12825-PA 1..432 17..448 2160 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-RA 585 CG12825-RA 49..482 15..448 2170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7789570..7789712 193..335 700 99.3 Plus
2R 25286936 2R 7789770..7789885 333..448 580 100 Plus
2R 25286936 2R 7789254..7789358 15..119 525 100 Plus
2R 25286936 2R 7789421..7789500 120..199 400 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:56:52 has no hits.

BO26193.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:57 Download gff for BO26193.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 43..474 17..450 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:32 Download gff for BO26193.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 51..482 17..450 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:24 Download gff for BO26193.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 51..482 17..450 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:24 Download gff for BO26193.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789256..7789358 17..119 100 -> Plus
2R 7789421..7789500 120..199 100 -> Plus
2R 7789577..7789712 200..335 100 -> Plus
2R 7789773..7789885 336..450 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:32 Download gff for BO26193.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3676761..3676863 17..119 100 -> Plus
arm_2R 3676926..3677005 120..199 100 -> Plus
arm_2R 3677082..3677217 200..335 100 -> Plus
arm_2R 3677278..3677390 336..450 98   Plus

BO26193.pep Sequence

Translation from 16 to 466

> BO26193.pep
MWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEMGIHISALQIL
GSVVLIVGAIKQKHKFFVPWMITTGFFLYLMVNLFISLIVQGTAWIFGPL
MVVPFTAYLGCALYSVQKAFDRMRKEEPPAYASLSDKKEFINHIASFLDH

BO26193.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-PA 144 CG12825-PA 1..144 1..144 761 100 Plus
CG12824-PB 142 CG12824-PB 1..142 1..144 327 49 Plus
CG12824-PA 87 CG12824-PA 1..62 1..64 151 50 Plus