Clone BO26248 Report

Search the DGRC for BO26248

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:262
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG34168-RA
Protein status:BO26248.pep: Inserted from web
Sequenced Size:214

Clone Sequence Records

BO26248.complete Sequence

214 bp assembled on 2010-06-29

GenBank Submission: KX798598

> BO26248.complete
GAAGTTATCAGTCGACATGTGCAATCCAGGAATGTGCTCGATGCCCGGCA
CTTGCTGTGGACCGACTGGCGGACTGGGACCCTGCCTGCTCTGCGGACCC
TACAATGGCCAGTGGTTCCGTTCGGTCAACCACTGTTGCGGTCCTTGTGG
CCCATATGGTTGCTGCTCATGCTACGGGCCGTATGGTGGACATTGTGCAA
GCTTTCTAGACCAT

BO26248.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:34:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-RA 183 CG34168-PA 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-RA 492 CG34168-RA 118..297 17..196 900 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:34:19
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16134909..16135088 196..17 900 100 Minus
Blast to na_te.dros performed on 2014-11-26 14:34:20 has no hits.

BO26248.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:46:00 Download gff for BO26248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 83..262 17..198 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:37 Download gff for BO26248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 118..297 17..198 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:47 Download gff for BO26248.complete
Subject Subject Range Query Range Percent Splice Strand
CG34168-RA 118..297 17..198 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:47 Download gff for BO26248.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16134905..16135088 17..198 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:37 Download gff for BO26248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16134905..16135088 17..198 98   Minus

BO26248.pep Sequence

Translation from 16 to 214

> BO26248.pep
MCNPGMCSMPGTCCGPTGGLGPCLLCGPYNGQWFRSVNHCCGPCGPYGCC
SCYGPYGGHCASFLDH

BO26248.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34168-PA 60 CG34168-PA 1..60 1..60 399 100 Plus
Mst84Da-PA 63 CG17946-PA 6..57 3..60 134 46.6 Plus