BO26248.complete Sequence
214 bp assembled on 2010-06-29
GenBank Submission: KX798598
> BO26248.complete
GAAGTTATCAGTCGACATGTGCAATCCAGGAATGTGCTCGATGCCCGGCA
CTTGCTGTGGACCGACTGGCGGACTGGGACCCTGCCTGCTCTGCGGACCC
TACAATGGCCAGTGGTTCCGTTCGGTCAACCACTGTTGCGGTCCTTGTGG
CCCATATGGTTGCTGCTCATGCTACGGGCCGTATGGTGGACATTGTGCAA
GCTTTCTAGACCAT
BO26248.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:34:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34168-RA | 183 | CG34168-PA | 1..180 | 17..196 | 900 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:34:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34168-RA | 492 | CG34168-RA | 118..297 | 17..196 | 900 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:34:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16134909..16135088 | 196..17 | 900 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 14:34:20 has no hits.
BO26248.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-29 17:46:00 Download gff for
BO26248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 83..262 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:37:37 Download gff for
BO26248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 118..297 | 17..198 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:55:47 Download gff for
BO26248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34168-RA | 118..297 | 17..198 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 15:55:47 Download gff for
BO26248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16134905..16135088 | 17..198 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:37:37 Download gff for
BO26248.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16134905..16135088 | 17..198 | 98 | | Minus |
BO26248.pep Sequence
Translation from 16 to 214
> BO26248.pep
MCNPGMCSMPGTCCGPTGGLGPCLLCGPYNGQWFRSVNHCCGPCGPYGCC
SCYGPYGGHCASFLDH
BO26248.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:35:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34168-PA | 60 | CG34168-PA | 1..60 | 1..60 | 399 | 100 | Plus |
Mst84Da-PA | 63 | CG17946-PA | 6..57 | 3..60 | 134 | 46.6 | Plus |