Clone BO26285 Report

Search the DGRC for BO26285

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:262
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptCG13056-RA
Protein status:BO26285.pep: Inserted from web
Sequenced Size:331

Clone Sequence Records

BO26285.complete Sequence

331 bp assembled on 2010-06-29

GenBank Submission: KX799892

> BO26285.complete
GAAGTTATCAGTCGACATGTCACAGAGAATGTACTTATCCTTTGCTCTCT
TACTTTGCCTTTTGGCACTTGGAAATGCCGATCTGCAATTGTATCATCCC
CTGATGACCCTGCACCACCCACCAACTTTTGCCAAGGTGGGCCATCTGGT
GGAGCATGTGCCCACCGCAGTTTCGCACCAGAGTTCCACCATCGTTCATC
GCAGTGTTCCGAGGACTACATCACTGTTGACACCCGCTTTGAGGTCCACC
TATCTGAACTATCCCACCTGGGGTTATCCACTTTTCGATGGCACCAACAC
GCTGTACAGAAAGGCAAGCTTTCTAGACCAT

BO26285.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:57:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-RA 300 CG13056-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:57:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-RA 402 CG13056-RA 23..319 17..313 1485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16333417..16333699 31..313 1415 100 Plus
Blast to na_te.dros performed on 2014-11-27 00:56:59 has no hits.

BO26285.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:56:59 Download gff for BO26285.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 18..314 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:39:38 Download gff for BO26285.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 23..319 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:14:27 Download gff for BO26285.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 23..319 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:14:27 Download gff for BO26285.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16333418..16333699 32..315 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:39:38 Download gff for BO26285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16326518..16326799 32..315 99   Plus

BO26285.pep Sequence

Translation from 16 to 331

> BO26285.pep
MSQRMYLSFALLLCLLALGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPT
AVSHQSSTIVHRSVPRTTSLLTPALRSTYLNYPTWGYPLFDGTNTLYRKA
SFLDH

BO26285.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-PA 99 CG13056-PA 1..99 1..99 527 100 Plus