Clone BO26330 Report

Search the DGRC for BO26330

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:263
Well:30
Vector:pDNR-Dual
Associated Gene/TranscriptCG7370-RA
Protein status:BO26330.pep: Imported from assembly
Sequenced Size:256

Clone Sequence Records

BO26330.complete Sequence

256 bp assembled on 2010-07-01

GenBank Submission: KX796387

> BO26330.complete
GAAGTTATCAGTCGACATGCGACGTTGGCCCAAGTCAACACTTAACATTA
ACAAATGCCTTACTACAATACTGGTCGGCCAATTTGTTCTTTGCTTTTTG
TCTGGCGCTTTTCATTATTATTGTTTGTTTGGCGGCGACGGCGGCGCCCG
TAAAAAGCCGTTAGAAAAGCGGGAAGCTGAATTCGTTGGCGTTGGTAAGT
CGCGAAGCAAAAAAACGTACGAAAACGCACTTTTATTTGCAAGCTTTCTA
GACCAT

BO26330.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG7370-RA 225 CG7370-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7370-RA 1410 CG7370-RA 287..508 17..238 1110 100 Plus
Syn1-RD 3741 CG7152-RD 116..337 238..17 1110 100 Minus
Syn1-RC 3735 CG7152-RC 116..337 238..17 1110 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21770198..21770419 17..238 1110 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:03:22 has no hits.

BO26330.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:04:09 Download gff for BO26330.complete
Subject Subject Range Query Range Percent Splice Strand
CG7370-RA 287..508 17..240 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:09:31 Download gff for BO26330.complete
Subject Subject Range Query Range Percent Splice Strand
CG7370-RA 287..508 17..240 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:20:43 Download gff for BO26330.complete
Subject Subject Range Query Range Percent Splice Strand
Syn1-RC 114..337 17..240 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:20:43 Download gff for BO26330.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21770198..21770419 17..240 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:09:31 Download gff for BO26330.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21763298..21763519 17..240 99   Plus

BO26330.pep Sequence

Translation from 16 to 256

> BO26330.pep
MRRWPKSTLNINKCLTTILVGQFVLCFLSGAFHYYCLFGGDGGARKKPLE
KREAEFVGVGKSRSKKTYENALLFASFLDH

BO26330.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7370-PA 74 CG7370-PA 1..74 1..74 396 100 Plus