Clone BO26341 Report

Search the DGRC for BO26341

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:263
Well:41
Vector:pDNR-Dual
Associated Gene/Transcriptl(2)35Di-RB
Protein status:BO26341.pep: Imported from assembly
Sequenced Size:448

Clone Sequence Records

BO26341.complete Sequence

448 bp assembled on 2010-07-01

GenBank Submission: KX797533

> BO26341.complete
GAAGTTATCAGTCGACATGGTAGCTGGTGGTGCCTCGGAAACGGGCGGCG
TGAAGCCGATGGTAATTGCGGGCCGCATGGTGCGGGAGCGTGAGCGCCTG
ATCGGCATGTCGCCGGAGGAGCGCGCCTGGCGCAAACAGTGGCTGAAGGA
CCAGGAGCTGCACCATGGACCCCGCAAGGTGCCCGCCCTGGAGCTGGAGC
TGAACAACCCCATCAAGCGCTTCTACCGCGCTCCCCTCGACAAGGTCTGC
AATGTTTTGGAACCCGTCCTGGGCTTTCAGCGCGCGTACACCGTGCGCTT
CTGGACCGGAAAGGCTCTGCTCGCCCTAACCGGAATCTACGCCGGCGCCT
ACTACTTCAAGTACAACCAGAATGTAAGTAATTGGTCGAGGATTCAAGTT
GGCTATTACTATAAGTCATTCCAAATGTACGCAAGCTTTCTAGACCAT

BO26341.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)35Di-RC 504 CG13240-PC 1..358 17..374 1790 100 Plus
l(2)35Di-RA 504 CG13240-PA 1..358 17..374 1790 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:03:16
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)35Di-RC 992 CG13240-RC 103..460 17..374 1790 100 Plus
l(2)35Di-RA 710 CG13240-RA 103..460 17..374 1790 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:03:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15750721..15750976 272..17 1280 100 Minus
2L 23513712 2L 15750493..15750652 430..271 800 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:03:14 has no hits.

BO26341.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:04:07 Download gff for BO26341.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RB 79..492 17..432 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:09:26 Download gff for BO26341.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 103..460 17..374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:20:40 Download gff for BO26341.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)35Di-RA 103..460 17..374 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:20:40 Download gff for BO26341.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15750491..15750651 272..432 98 <- Minus
2L 15750722..15750976 17..271 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:09:26 Download gff for BO26341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15750491..15750651 272..432 98 <- Minus
arm_2L 15750722..15750976 17..271 100   Minus

BO26341.pep Sequence

Translation from 16 to 448

> BO26341.pep
MVAGGASETGGVKPMVIAGRMVRERERLIGMSPEERAWRKQWLKDQELHH
GPRKVPALELELNNPIKRFYRAPLDKVCNVLEPVLGFQRAYTVRFWTGKA
LLALTGIYAGAYYFKYNQNVSNWSRIQVGYYYKSFQMYASFLDH

BO26341.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)35Di-PC 167 CG13240-PC 1..123 1..125 638 96.8 Plus
l(2)35Di-PA 167 CG13240-PA 1..123 1..125 638 96.8 Plus