Clone BO26435 Report

Search the DGRC for BO26435

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:264
Well:35
Vector:pDNR-Dual
Associated Gene/TranscriptCG34317-RA
Protein status:BO26435.pep: Imported from assembly
Sequenced Size:367

Clone Sequence Records

BO26435.complete Sequence

367 bp assembled on 2010-07-01

GenBank Submission: KX795228

> BO26435.complete
GAAGTTATCAGTCGACATGAGTGGTTACCAATATCTGGACGTGAAGATAA
AACTCCGTGATCCAGACTCCGTGACTCTGACGCCCGTATTCTTCTGTGGC
TGCATCCATAGCTCCTTGGCTAGTATTTTTGGCGAAATAGGTGGCCAGAC
CATACTGGAAATTGTGAAATTTAGTTCCAGCCAAAAACGCTCCATTCTCC
GGGTGCCCGAGAACGTCCTGGATCGCGTTCGCGTAGCTATAGCCCTAATA
GGATACTACCAGGAGGTGCCCTGCCATTTTCAGGTGCTCAGCACATCCCG
AAAGCCCTTGGATTTTGAGGAATCCCCCGAGGAGTTTGTAGCATTTAACG
CAAGCTTTCTAGACCAT

BO26435.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34317-RA 336 CG34317-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG7950-RA 1168 CG7950-RA 144..477 16..349 1670 100 Plus
CG34317-RA 1168 CG34317-RA 144..477 16..349 1670 100 Plus
CG7950-RB 1192 CG7950-RB 201..501 49..349 1505 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:58:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30057140..30057440 49..349 1505 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:58:56 has no hits.

BO26435.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:02:52 Download gff for BO26435.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 151..483 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:07:21 Download gff for BO26435.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 145..477 17..351 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:47 Download gff for BO26435.complete
Subject Subject Range Query Range Percent Splice Strand
CG34317-RA 145..477 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:47 Download gff for BO26435.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30057003..30057034 17..48 100 -> Plus
3R 30057140..30057440 49..351 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:07:21 Download gff for BO26435.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25882725..25882756 17..48 100 -> Plus
arm_3R 25882862..25883162 49..351 99   Plus

BO26435.pep Sequence

Translation from 16 to 367

> BO26435.pep
MSGYQYLDVKIKLRDPDSVTLTPVFFCGCIHSSLASIFGEIGGQTILEIV
KFSSSQKRSILRVPENVLDRVRVAIALIGYYQEVPCHFQVLSTSRKPLDF
EESPEEFVAFNASFLDH

BO26435.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34317-PA 111 CG34317-PA 1..111 1..111 568 100 Plus
CG15526-PA 112 CG15526-PA 1..107 1..109 283 51.4 Plus