Clone BO26439 Report

Search the DGRC for BO26439

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:264
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG34261-RA
Protein status:BO26439.pep: Imported from assembly
Sequenced Size:253

Clone Sequence Records

BO26439.complete Sequence

253 bp assembled on 2010-07-01

GenBank Submission: KX793907

> BO26439.complete
GAAGTTATCAGTCGACATGGTAAATTTGCCTATTTTCCAGAAACAAATTT
GGACAGTTGTTGAATTTGCAGAGACAAAATGTTCAGCCAGGCGGCGTGGC
TGTCCTTCAGGACCAGCAGCGATTTATTTACTATCTGATCACCAAGAAAT
CCAGCTGGGGAAAGCCCACCTACGAACTTCTCCAGAGTTCCTTGATCGCC
ATGCGAAAACACATGGTATGTTTATGTATCTTCTAGCAAGCTTTCTAGAC
CAT

BO26439.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34261-RB 447 CG34261-PB 122..297 40..215 880 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG34261-RB 796 CG34261-RB 187..362 40..215 880 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:58:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21197047..21197265 17..235 1095 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:58:41 has no hits.

BO26439.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:02:47 Download gff for BO26439.complete
Subject Subject Range Query Range Percent Splice Strand
CG34261-RA 201..419 17..237 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:07:14 Download gff for BO26439.complete
Subject Subject Range Query Range Percent Splice Strand
CG34261-RB 183..362 34..215 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:42 Download gff for BO26439.complete
Subject Subject Range Query Range Percent Splice Strand
CG34261-RB 183..362 34..215 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:42 Download gff for BO26439.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21197047..21197265 17..237 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:07:14 Download gff for BO26439.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21190147..21190365 17..237 99   Plus

BO26439.pep Sequence

Translation from 16 to 253

> BO26439.pep
MVNLPIFQKQIWTVVEFAETKCSARRRGCPSGPAAIYLLSDHQEIQLGKA
HLRTSPEFLDRHAKTHGMFMYLLASFLDH
Sequence BO26439.pep has no blast hits.