BO26521.complete Sequence
343 bp assembled on 2010-07-01
GenBank Submission: KX796059
> BO26521.complete
GAAGTTATCAGTCGACATGGCCGACGAAACAGAGCAGCTCAGTCAGGTGA
TTTTGCCGGTAAAGGAGCCTTTGGATCTCATCCGATTGAGTTTAGATGAG
AAGGTGTACGTAAAGATGCGCAACGAGCGGGAACTGCGAGGACGTCTTCA
CGCCTTTGATCAACATTTGAACATGGTGCTCGGCGATGCGGAGGAGACGG
TGACCACTGTGGAGATCGACGAGGAGACCTATGAGGAGGTGTACAAGACC
GCCAAGCGCACTATTCCCATGCTATTCGTTAGAGGCGATGGAGTCATCCT
GGTTTCGCCACCCATGCGGGTGGGCGCAAGCTTTCTAGACCAT
BO26521.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-RB | 312 | CG31184-PB | 1..309 | 17..325 | 1530 | 99.7 | Plus |
LSm3-RA | 312 | CG31184-PA | 1..309 | 17..325 | 1530 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-RB | 491 | CG31184-RB | 105..413 | 17..325 | 1530 | 99.7 | Plus |
LSm3-RA | 643 | CG31184-RA | 257..565 | 17..325 | 1530 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23996766..23996939 | 152..325 | 855 | 99.4 | Plus |
3R | 32079331 | 3R | 23996588..23996706 | 34..152 | 595 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:01:55 has no hits.
BO26521.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:39 Download gff for
BO26521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31184-RA | 257..565 | 17..327 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:45 Download gff for
BO26521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 257..565 | 17..327 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:20:05 Download gff for
BO26521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm3-RA | 257..565 | 17..327 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:20:05 Download gff for
BO26521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23996518..23996538 | 17..37 | 100 | -> | Plus |
3R | 23996592..23996705 | 38..151 | 100 | -> | Plus |
3R | 23996766..23996939 | 152..327 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:45 Download gff for
BO26521.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19822240..19822260 | 17..37 | 100 | -> | Plus |
arm_3R | 19822314..19822427 | 38..151 | 100 | -> | Plus |
arm_3R | 19822488..19822661 | 152..327 | 98 | | Plus |
BO26521.pep Sequence
Translation from 16 to 343
> BO26521.pep
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVGASFLDH
BO26521.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:22:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm3-PB | 103 | CG31184-PB | 1..103 | 1..103 | 517 | 100 | Plus |
LSm3-PA | 103 | CG31184-PA | 1..103 | 1..103 | 517 | 100 | Plus |