Clone BO26521 Report

Search the DGRC for BO26521

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:265
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptLSm3-RA
Protein status:BO26521.pep: Imported from assembly
Sequenced Size:343

Clone Sequence Records

BO26521.complete Sequence

343 bp assembled on 2010-07-01

GenBank Submission: KX796059

> BO26521.complete
GAAGTTATCAGTCGACATGGCCGACGAAACAGAGCAGCTCAGTCAGGTGA
TTTTGCCGGTAAAGGAGCCTTTGGATCTCATCCGATTGAGTTTAGATGAG
AAGGTGTACGTAAAGATGCGCAACGAGCGGGAACTGCGAGGACGTCTTCA
CGCCTTTGATCAACATTTGAACATGGTGCTCGGCGATGCGGAGGAGACGG
TGACCACTGTGGAGATCGACGAGGAGACCTATGAGGAGGTGTACAAGACC
GCCAAGCGCACTATTCCCATGCTATTCGTTAGAGGCGATGGAGTCATCCT
GGTTTCGCCACCCATGCGGGTGGGCGCAAGCTTTCTAGACCAT

BO26521.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
LSm3-RB 312 CG31184-PB 1..309 17..325 1530 99.7 Plus
LSm3-RA 312 CG31184-PA 1..309 17..325 1530 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
LSm3-RB 491 CG31184-RB 105..413 17..325 1530 99.7 Plus
LSm3-RA 643 CG31184-RA 257..565 17..325 1530 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23996766..23996939 152..325 855 99.4 Plus
3R 32079331 3R 23996588..23996706 34..152 595 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:01:55 has no hits.

BO26521.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:39 Download gff for BO26521.complete
Subject Subject Range Query Range Percent Splice Strand
CG31184-RA 257..565 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:45 Download gff for BO26521.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 257..565 17..327 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:20:05 Download gff for BO26521.complete
Subject Subject Range Query Range Percent Splice Strand
LSm3-RA 257..565 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:20:05 Download gff for BO26521.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23996518..23996538 17..37 100 -> Plus
3R 23996592..23996705 38..151 100 -> Plus
3R 23996766..23996939 152..327 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:45 Download gff for BO26521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19822240..19822260 17..37 100 -> Plus
arm_3R 19822314..19822427 38..151 100 -> Plus
arm_3R 19822488..19822661 152..327 98   Plus

BO26521.pep Sequence

Translation from 16 to 343

> BO26521.pep
MADETEQLSQVILPVKEPLDLIRLSLDEKVYVKMRNERELRGRLHAFDQH
LNMVLGDAEETVTTVEIDEETYEEVYKTAKRTIPMLFVRGDGVILVSPPM
RVGASFLDH

BO26521.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
LSm3-PB 103 CG31184-PB 1..103 1..103 517 100 Plus
LSm3-PA 103 CG31184-PA 1..103 1..103 517 100 Plus