Clone BO26526 Report

Search the DGRC for BO26526

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:265
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptCG32817-RA
Protein status:BO26526.pep: Imported from assembly
Sequenced Size:397

Clone Sequence Records

BO26526.complete Sequence

397 bp assembled on 2010-07-01

GenBank Submission: KX795628

> BO26526.complete
GAAGTTATCAGTCGACATGCTTTTCGATGGCGCAACCGGCAATGGGCACG
GTCAGGGCCAGAATACCCTGAATCCATTGGGGCCAGGCCAGGAGGAGCCC
GCCCTATGCGAGCAGTACTATCTGCTGGGCGATGGTTCCATCATTCTGCG
CAACCATTCCATCGACTTGTCGAATCCGCCCCTGAAATCGCGCTGCTGCC
AGCTCCCAACACTCATCCACGACATATGCGTCAACTGCGTGATGGATCTC
TGCGAGGAGTGTGGCTACTCCTGCGGCGAGTGCGCCAAGTTTATTTGCCG
CAACTGCGTGACTTTATTTGGTAATCGAATTGAAGAAGAGGAGGCTCCGC
TGTGCGAGCACTGCCAGATGTTCCTCAGCGCAAGCTTTCTAGACCAT

BO26526.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-RB 366 CG32817-PB 1..363 17..379 1815 100 Plus
CG32817-RC 366 CG32817-PC 1..363 17..379 1815 100 Plus
CG32817-RA 366 CG32817-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-RB 580 CG32817-RB 142..504 17..379 1815 100 Plus
CG32817-RC 837 CG32817-RC 399..761 17..379 1815 100 Plus
CG32817-RA 532 CG32817-RA 94..456 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 479644..479945 17..318 1510 100 Plus
X 23542271 X 482132..482433 17..318 1480 99.3 Plus
X 23542271 X 477621..477931 17..318 1040 89.7 Plus
X 23542271 X 480030..480090 319..379 305 100 Plus
X 23542271 X 482518..482578 319..379 290 98.4 Plus
X 23542271 X 478013..478073 319..379 230 91.8 Plus
Blast to na_te.dros performed on 2014-11-28 02:01:42 has no hits.

BO26526.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:35 Download gff for BO26526.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RB 127..489 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:39 Download gff for BO26526.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 94..456 17..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:19:57 Download gff for BO26526.complete
Subject Subject Range Query Range Percent Splice Strand
CG32817-RA 94..456 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:19:57 Download gff for BO26526.complete
Subject Subject Range Query Range Percent Splice Strand
X 479644..479945 17..318 100 -> Plus
X 480030..480090 319..381 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:39 Download gff for BO26526.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 373677..373978 17..318 100 -> Plus
arm_X 374063..374123 319..381 96   Plus

BO26526.pep Sequence

Translation from 16 to 397

> BO26526.pep
MLFDGATGNGHGQGQNTLNPLGPGQEEPALCEQYYLLGDGSIILRNHSID
LSNPPLKSRCCQLPTLIHDICVNCVMDLCEECGYSCGECAKFICRNCVTL
FGNRIEEEEAPLCEHCQMFLSASFLDH

BO26526.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32817-PB 121 CG32817-PB 1..121 1..121 683 100 Plus
CG32817-PC 121 CG32817-PC 1..121 1..121 683 100 Plus
CG32817-PA 121 CG32817-PA 1..121 1..121 683 100 Plus
CG3176-PD 121 CG3176-PD 1..121 1..121 664 97.5 Plus
CG3176-PA 121 CG3176-PA 1..121 1..121 664 97.5 Plus