Clone BO26532 Report

Search the DGRC for BO26532

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:265
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG32368-RA
Protein status:BO26532.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO26532.complete Sequence

298 bp assembled on 2010-07-01

GenBank Submission: KX797017

> BO26532.complete
GAAGTTATCAGTCGACATGGATGGTGCCATTGCAATGAATCATGTGGTGG
AATCCGACAAGGAGAAGAGGCAATTTAAACTGAAAATTATGGAGCTCGAG
CACGAAATGAGGATGGAAAAGGATCCAGCTCGCGCCAAGATGATCGAGGA
GCACATTGAGAAATTGAAGAAACTGGATGAGGAGAACCAAAAGCGGAACT
TGGAAATTGCCAAGGCAAACGTGATGTTAATGACAGCGAATACAAAGTTT
AGAGTGGGTTATCATATTATTAACAACCTTGCAAGCTTTCTAGACCAT

BO26532.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-RA 267 CG32368-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-RA 410 CG32368-RA 57..320 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7915493..7915756 17..280 1320 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:01:27 has no hits.

BO26532.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:30 Download gff for BO26532.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 58..321 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:29 Download gff for BO26532.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 57..320 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:19:51 Download gff for BO26532.complete
Subject Subject Range Query Range Percent Splice Strand
CG32368-RA 57..320 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:19:51 Download gff for BO26532.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7915493..7915756 17..282 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:29 Download gff for BO26532.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7908593..7908856 17..282 99   Plus

BO26532.pep Sequence

Translation from 16 to 298

> BO26532.pep
MDGAIAMNHVVESDKEKRQFKLKIMELEHEMRMEKDPARAKMIEEHIEKL
KKLDEENQKRNLEIAKANVMLMTANTKFRVGYHIINNLASFLDH

BO26532.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:21:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG32368-PA 88 CG32368-PA 1..88 1..88 445 100 Plus