BO26538.complete Sequence
343 bp assembled on 2010-07-01
GenBank Submission: KX795444
> BO26538.complete
GAAGTTATCAGTCGACATGGAAAGGAAACCAAGTATACCAAAAATCAGGC
AGGTCAGCAGTCTTGGAAGTCAATTCACTTTTCCCAATATAGCGGATCTA
TTTTGCAATGCCGTCTCCATTCACAATGACTATTGTAAATTGCATTTTAT
AAACGAAAAGTTGCAATTCCATTTAAATGGAATGTTGGAAAGTAAAGATG
CTTCAGCGATTTACTATTTTAAGCAACATATTATTCTAAACTCGGATCAA
CTGGAATCTGCATCCAAAAATTATGACATGACCTTTCATACAATAATGAG
AAGGTGGGAAACTGACCGGAAAACGGCAAGCTTTCTAGACCAT
BO26538.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG17490-RC | 405 | CG17490-PC | 94..402 | 17..325 | 1545 | 100 | Plus |
| CG17490-RD | 312 | CG17490-PD | 1..309 | 17..325 | 1545 | 100 | Plus |
| CG17490-RF | 393 | CG17490-PF | 1..284 | 17..300 | 1420 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG17490-RC | 1394 | CG17490-RC | 217..525 | 17..325 | 1545 | 100 | Plus |
| CG17490-RD | 1342 | CG17490-RD | 149..457 | 17..325 | 1545 | 100 | Plus |
| CG17490-RF | 2953 | CG17490-RF | 1756..2039 | 17..300 | 1420 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 22540043..22540324 | 17..298 | 1410 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 02:01:23
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Dkoe\Gandalf | 979 | Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). | 42..82 | 179..138 | 108 | 76.2 | Minus |
BO26538.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:28 Download gff for
BO26538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG17490-RD | 147..455 | 17..327 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:26 Download gff for
BO26538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG17490-RD | 147..455 | 17..327 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:19:50 Download gff for
BO26538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG17490-RD | 149..457 | 17..327 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:19:50 Download gff for
BO26538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 22540043..22540324 | 17..298 | 100 | -> | Plus |
| 2L | 22547540..22547566 | 299..327 | 93 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:26 Download gff for
BO26538.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 22432775..22433056 | 17..298 | 100 | -> | Plus |
| arm_2L | 22440272..22440298 | 299..327 | 93 | | Plus |
BO26538.pep Sequence
Translation from 16 to 343
> BO26538.pep
MERKPSIPKIRQVSSLGSQFTFPNIADLFCNAVSIHNDYCKLHFINEKLQ
FHLNGMLESKDASAIYYFKQHIILNSDQLESASKNYDMTFHTIMRRWETD
RKTASFLDH
BO26538.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:21:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG17490-PD | 103 | CG17490-PD | 1..103 | 1..103 | 546 | 100 | Plus |
| CG17490-PC | 134 | CG17490-PC | 32..134 | 1..103 | 546 | 100 | Plus |
| CG17490-PF | 130 | CG17490-PF | 1..94 | 1..94 | 494 | 100 | Plus |
| CG17490-PA | 130 | CG17490-PA | 1..94 | 1..94 | 494 | 100 | Plus |
| CG17490-PG | 707 | CG17490-PG | 578..671 | 1..94 | 494 | 100 | Plus |
