Clone BO26559 Report

Search the DGRC for BO26559

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:265
Well:59
Vector:pDNR-Dual
Associated Gene/Transcriptpgc-RA
Protein status:BO26559.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO26559.complete Sequence

247 bp assembled on 2010-07-01

GenBank Submission: KX797986

> BO26559.complete
GAAGTTATCAGTCGACATGTGCGACTACCAGATGGAGTACTCCTTTATTT
TTGAAGACAGCTCCTGCGAGGGCGATGCCTCGATGGCATCCTACGACAAT
GGATTCGAGTCCATGTGGCATCAAGTGCGCGAGGAGTTGCAAAGGGAGCG
GGAGATGAATGAGCTCTGCCAGGTTTTCCAGCAAAACTTGAGCCTGAGTC
CGCCGGTCATCGCGGATAGATGGAGATTCGCAAGCTTTCTAGACCAT

BO26559.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:11
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-RD 216 CG32885-PD 1..213 17..229 1065 100 Plus
pgc-RA 216 CG32885-PA 1..213 17..229 1065 100 Plus
pgc-RC 216 CG32885-PC 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-RD 643 CG32885-RD 27..239 17..229 1065 100 Plus
pgc-RA 1211 CG32885-RA 595..807 17..229 1065 100 Plus
pgc-RC 686 CG32885-RC 70..282 17..229 1065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22332197..22332409 17..229 1065 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:01:10 has no hits.

BO26559.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:25 Download gff for BO26559.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RA 549..761 17..231 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:21 Download gff for BO26559.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 70..282 17..231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:19:43 Download gff for BO26559.complete
Subject Subject Range Query Range Percent Splice Strand
pgc-RC 70..282 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:19:43 Download gff for BO26559.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22332197..22332409 17..231 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:21 Download gff for BO26559.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18219702..18219914 17..231 99   Plus

BO26559.pep Sequence

Translation from 16 to 247

> BO26559.pep
MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNEL
CQVFQQNLSLSPPVIADRWRFASFLDH

BO26559.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:21:37
Subject Length Description Subject Range Query Range Score Percent Strand
pgc-PD 71 CG32885-PD 1..71 1..71 387 100 Plus
pgc-PA 71 CG32885-PA 1..71 1..71 387 100 Plus
pgc-PC 71 CG32885-PC 1..71 1..71 387 100 Plus
CG34207-PA 101 CG34207-PA 3..99 7..76 142 38.1 Plus