BO26559.complete Sequence
247 bp assembled on 2010-07-01
GenBank Submission: KX797986
> BO26559.complete
GAAGTTATCAGTCGACATGTGCGACTACCAGATGGAGTACTCCTTTATTT
TTGAAGACAGCTCCTGCGAGGGCGATGCCTCGATGGCATCCTACGACAAT
GGATTCGAGTCCATGTGGCATCAAGTGCGCGAGGAGTTGCAAAGGGAGCG
GGAGATGAATGAGCTCTGCCAGGTTTTCCAGCAAAACTTGAGCCTGAGTC
CGCCGGTCATCGCGGATAGATGGAGATTCGCAAGCTTTCTAGACCAT
BO26559.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:01:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pgc-RD | 216 | CG32885-PD | 1..213 | 17..229 | 1065 | 100 | Plus |
pgc-RA | 216 | CG32885-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
pgc-RC | 216 | CG32885-PC | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:01:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pgc-RD | 643 | CG32885-RD | 27..239 | 17..229 | 1065 | 100 | Plus |
pgc-RA | 1211 | CG32885-RA | 595..807 | 17..229 | 1065 | 100 | Plus |
pgc-RC | 686 | CG32885-RC | 70..282 | 17..229 | 1065 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:01:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22332197..22332409 | 17..229 | 1065 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:01:10 has no hits.
BO26559.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:03:25 Download gff for
BO26559.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pgc-RA | 549..761 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:08:21 Download gff for
BO26559.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pgc-RC | 70..282 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:19:43 Download gff for
BO26559.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pgc-RC | 70..282 | 17..231 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:19:43 Download gff for
BO26559.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22332197..22332409 | 17..231 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:08:21 Download gff for
BO26559.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18219702..18219914 | 17..231 | 99 | | Plus |
BO26559.pep Sequence
Translation from 16 to 247
> BO26559.pep
MCDYQMEYSFIFEDSSCEGDASMASYDNGFESMWHQVREELQREREMNEL
CQVFQQNLSLSPPVIADRWRFASFLDH
BO26559.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:21:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pgc-PD | 71 | CG32885-PD | 1..71 | 1..71 | 387 | 100 | Plus |
pgc-PA | 71 | CG32885-PA | 1..71 | 1..71 | 387 | 100 | Plus |
pgc-PC | 71 | CG32885-PC | 1..71 | 1..71 | 387 | 100 | Plus |
CG34207-PA | 101 | CG34207-PA | 3..99 | 7..76 | 142 | 38.1 | Plus |