BO26690.complete Sequence
268 bp assembled on 2010-07-01
GenBank Submission: KX798356
> BO26690.complete
GAAGTTATCAGTCGACATGCTGCAACTTCAAAAGATGAATACTCTGCTGC
TGCTCTTGGCCATGATGCGCTGCATCTGTGCCACGCCCATAGCTCCTGCC
ACGCCCGATGGCGCCACGCCCATCGACGCCCGCGTCTCGGCCGCCGACTT
CGGAGCCCAGGATGCTTTCGATGCCGCCGACAGCTCCGCGGAATCCACCC
ACGCGCAGGCCAGCGACGCCGGGTTCAAGGTGAGTAACCGAGGTATACTT
GCAAGCTTTCTAGACCAT
BO26690.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:02:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5928-RB | 237 | CG5928-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
CG5928-RC | 600 | CG5928-PC | 1..213 | 17..229 | 1065 | 100 | Plus |
CG5928-RA | 552 | CG5928-PA | 1..213 | 17..229 | 1065 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:03:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5928-RB | 863 | CG5928-RB | 134..367 | 17..250 | 1170 | 100 | Plus |
CG5928-RC | 1182 | CG5928-RC | 134..346 | 17..229 | 1065 | 100 | Plus |
CG5928-RA | 806 | CG5928-RA | 134..346 | 17..229 | 1065 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:02:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 6068091..6068324 | 17..250 | 1170 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:02:58 has no hits.
BO26690.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:04:02 Download gff for
BO26690.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5928-RB | 132..365 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:09:19 Download gff for
BO26690.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5928-RB | 132..365 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:20:30 Download gff for
BO26690.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5928-RB | 134..367 | 17..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:20:30 Download gff for
BO26690.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 6068091..6068324 | 17..252 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:09:19 Download gff for
BO26690.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 5962124..5962357 | 17..252 | 99 | | Plus |
BO26690.pep Sequence
Translation from 16 to 268
> BO26690.pep
MLQLQKMNTLLLLLAMMRCICATPIAPATPDGATPIDARVSAADFGAQDA
FDAADSSAESTHAQASDAGFKVSNRGILASFLDH
BO26690.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:24:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5928-PB | 78 | CG5928-PB | 1..78 | 1..78 | 389 | 100 | Plus |
CG5928-PA | 183 | CG5928-PA | 1..73 | 1..73 | 363 | 98.6 | Plus |
CG5928-PC | 199 | CG5928-PC | 1..73 | 1..73 | 363 | 98.6 | Plus |