Clone BO26690 Report

Search the DGRC for BO26690

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:266
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG5928-RB
Protein status:BO26690.pep: Imported from assembly
Sequenced Size:268

Clone Sequence Records

BO26690.complete Sequence

268 bp assembled on 2010-07-01

GenBank Submission: KX798356

> BO26690.complete
GAAGTTATCAGTCGACATGCTGCAACTTCAAAAGATGAATACTCTGCTGC
TGCTCTTGGCCATGATGCGCTGCATCTGTGCCACGCCCATAGCTCCTGCC
ACGCCCGATGGCGCCACGCCCATCGACGCCCGCGTCTCGGCCGCCGACTT
CGGAGCCCAGGATGCTTTCGATGCCGCCGACAGCTCCGCGGAATCCACCC
ACGCGCAGGCCAGCGACGCCGGGTTCAAGGTGAGTAACCGAGGTATACTT
GCAAGCTTTCTAGACCAT

BO26690.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-RB 237 CG5928-PB 1..234 17..250 1170 100 Plus
CG5928-RC 600 CG5928-PC 1..213 17..229 1065 100 Plus
CG5928-RA 552 CG5928-PA 1..213 17..229 1065 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-RB 863 CG5928-RB 134..367 17..250 1170 100 Plus
CG5928-RC 1182 CG5928-RC 134..346 17..229 1065 100 Plus
CG5928-RA 806 CG5928-RA 134..346 17..229 1065 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 6068091..6068324 17..250 1170 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:02:58 has no hits.

BO26690.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-01 14:04:02 Download gff for BO26690.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 132..365 17..252 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:09:19 Download gff for BO26690.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 132..365 17..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:20:30 Download gff for BO26690.complete
Subject Subject Range Query Range Percent Splice Strand
CG5928-RB 134..367 17..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:20:30 Download gff for BO26690.complete
Subject Subject Range Query Range Percent Splice Strand
X 6068091..6068324 17..252 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:09:19 Download gff for BO26690.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 5962124..5962357 17..252 99   Plus

BO26690.pep Sequence

Translation from 16 to 268

> BO26690.pep
MLQLQKMNTLLLLLAMMRCICATPIAPATPDGATPIDARVSAADFGAQDA
FDAADSSAESTHAQASDAGFKVSNRGILASFLDH

BO26690.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:24:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG5928-PB 78 CG5928-PB 1..78 1..78 389 100 Plus
CG5928-PA 183 CG5928-PA 1..73 1..73 363 98.6 Plus
CG5928-PC 199 CG5928-PC 1..73 1..73 363 98.6 Plus