Clone BO26728 Report

Search the DGRC for BO26728

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:267
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG13043-RA
Protein status:BO26728.pep: Inserted from web
Sequenced Size:478

Clone Sequence Records

BO26728.complete Sequence

478 bp assembled on 2010-08-18

GenBank Submission: KX795696

> BO26728.complete
GAAGTTATCAGTCGACATGTTCAAGTTGGTGGTATTGTCTGCTCTGCTCG
CTGTAGCCGCTGCCCGTCCCGGTCACCTGTTGGAGTCCTCCCCGCTGGTC
TACGCTGCCCCAGCAGCGACGACCATCGTCCAGGAGCCCGTTCTGGCCAA
GGTGGGAGCCGTGGTCAAGAGCGTACCCACTGCCGTCAGCCACCAGAGCC
AGTCGGTGGTGCACAGTCACGCTCATGTTGTCGAGGATGTCGTTGCTCCC
GTGGTGAAGTCCACTCCGGTGGTCAGCTATGCTGCTGCCGCTCCAGTGGT
TCACACCTCCTATGCCGCTGCTCCCGTTGTCCACACCAGTTACGCTGCTC
CTGCTCCCGTTGTTCACACATCCTACGCCGCCGCCGCTCCCGTTCTGGCC
ACATCCTACGCCCAAGTGGCCGCCTCCTCGCCGCTGACCTACACCGCCAC
TGGTGTGTGGGCAAGCTTTCTAGACCAT

BO26728.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG13043-RA 447 CG13043-PA 1..444 17..460 2220 100 Plus
CG13063-RA 390 CG13063-PA 1..320 17..339 695 81.7 Plus
CG13044-RA 468 CG13044-PA 103..242 122..264 245 79.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG13043-RA 646 CG13043-RA 80..523 17..460 2220 100 Plus
CG13063-RA 544 CG13063-RA 46..367 15..339 705 81.8 Plus
CG13044-RA 624 CG13044-RA 168..307 122..264 245 79.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16305348..16305791 460..17 2220 100 Minus
3L 28110227 3L 16306720..16307028 28..339 655 81.4 Plus
3L 28110227 3L 16302807..16302946 264..122 245 79.7 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:28 has no hits.

BO26728.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:07 Download gff for BO26728.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 81..519 22..462 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:21:34 Download gff for BO26728.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 85..523 22..462 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:18:06 Download gff for BO26728.complete
Subject Subject Range Query Range Percent Splice Strand
CG13043-RA 85..523 22..462 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:18:06 Download gff for BO26728.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16305346..16305786 22..462 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:21:34 Download gff for BO26728.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16298446..16298886 22..462 99   Minus

BO26728.pep Sequence

Translation from 16 to 478

> BO26728.pep
MFKLVVLSALLAVAAARPGHLLESSPLVYAAPAATTIVQEPVLAKVGAVV
KSVPTAVSHQSQSVVHSHAHVVEDVVAPVVKSTPVVSYAAAAPVVHTSYA
AAPVVHTSYAAPAPVVHTSYAAAAPVLATSYAQVAASSPLTYTATGVWAS
FLDH

BO26728.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13043-PA 148 CG13043-PA 1..148 1..148 725 100 Plus
CG13063-PA 129 CG13063-PA 1..127 1..130 530 85.4 Plus
CG13044-PA 155 CG13044-PA 1..155 1..148 374 60.8 Plus
CG13042-PA 117 CG13042-PA 1..102 1..103 270 57.9 Plus
CG13060-PA 131 CG13060-PA 1..128 1..143 212 48.3 Plus