BO26785.complete Sequence
265 bp assembled on 2010-08-18
GenBank Submission: KX797418
> BO26785.complete
GAAGTTATCAGTCGACATGTCCGCCTACAAGCTGGAGACCGCCCCGTTCG
ACCCACGGTTCCCTAACCAGAACGTGACCCGCTACTGCTACCAGTCGTAC
ATCGACTTCCACCGCTGCCAGAAGAAGCGCGGCGAGGACTTCGCGCCCTG
CAACTACTTCCAGAAGGTCTACAAGTCGATGTGCCCCAACGCCTGGGTGG
AGAAGTGGGACGACCAGCGCGAGAGCGGCACATTCCCCGGCCGCATCGCA
AGCTTTCTAGACCAT
BO26785.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:57:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIb-RA | 291 | CG14235-PA | 56..288 | 15..247 | 1165 | 100 | Plus |
| CoVIb-RD | 234 | CG14235-PD | 1..231 | 17..247 | 1155 | 100 | Plus |
| CoVIb-RB | 234 | CG14235-PB | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:57:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIb-RD | 678 | CG14235-RD | 73..305 | 15..247 | 1165 | 100 | Plus |
| CoVIb-RB | 554 | CG14235-RB | 98..330 | 15..247 | 1165 | 100 | Plus |
| CoVIb-RC | 706 | CG14235-RC | 101..333 | 15..247 | 1165 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:57:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| X | 23542271 | X | 19740910..19741142 | 247..15 | 1165 | 100 | Minus |
Blast to na_te.dros performed 2014-11-28 08:57:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 622..706 | 31..120 | 105 | 61.1 | Plus |
BO26785.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:18 Download gff for
BO26785.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14235-RA | 140..370 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:40 Download gff for
BO26785.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIb-RC | 106..336 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:10 Download gff for
BO26785.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIb-RC | 103..333 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:10 Download gff for
BO26785.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| X | 19740908..19741140 | 17..249 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:40 Download gff for
BO26785.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_X | 19634941..19635173 | 17..249 | 99 | | Minus |
BO26785.pep Sequence
Translation from 16 to 265
> BO26785.pep
MSAYKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAPCNYFQK
VYKSMCPNAWVEKWDDQRESGTFPGRIASFLDH
BO26785.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:26:24
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIb-PD | 77 | CG14235-PD | 1..77 | 1..77 | 444 | 100 | Plus |
| CoVIb-PB | 77 | CG14235-PB | 1..77 | 1..77 | 444 | 100 | Plus |
| CoVIb-PC | 77 | CG14235-PC | 1..77 | 1..77 | 444 | 100 | Plus |
| CoVIb-PA | 96 | CG14235-PA | 20..96 | 1..77 | 444 | 100 | Plus |
