Clone BO26886 Report

Search the DGRC for BO26886

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:268
Well:86
Vector:pDNR-Dual
Associated Gene/TranscriptCG42457-RA
Protein status:BO26886.pep: Imported from assembly
Sequenced Size:748

Clone Sequence Records

BO26886.complete Sequence

748 bp assembled on 2010-08-18

GenBank Submission: KX798534

> BO26886.complete
GAAGTTATCAGTCGACATGGCAACAGCAACTGGCTCAAGCTGCTCCACCA
GTAACGGCAGTGGCAGCAGCAGCAACAGCAACCACAACAGCGCTGCGGTG
CAGCAACATCCGGTGGCATTCATCGAGTTCAAGGACCCACCGACCGCGTC
TCAGGCCATGCAGCAGCTGCAGGGTAAATATCTGCTCAGCTCCGATCGCG
GTTCCATCCGCATCGAGTTTGCGCGCAGCAAAATGATCAACGAGGTGACC
ATAATGAACACCAAGGCACCGCCACCACCACCACCCACTGCTGTTGCTGC
TACTGTTGCACCACCGCCACCGCCAGCACCCATGTACATCCTGAACGGCG
GTGGGGGGGTCGAGCATTTGCTGGTCCCAGCACCACCGCCGTCGGCACAG
CAGCAGCAGCAGCAGCAGCAGCAGCAACTCCAGATGCAGCAACTGCAACA
GCAGATGCACCTGCAGCAGCAACATCAACAGCAGCAGCAACTCCAATTGA
CCGTGGCAGCACCCTGCACTGCAGCAAGCACCACCACCCACAGCAGCACC
ACTAGCGTTGTTGTTAACTCACTACAGCACCACCAACTTCATCATCCAAA
TCAGCACCACCAAAATCATCTCTTTAGAGACCAACAGCAGCAGCATCAAC
AGCAAGCAACAATCAAGCAACAATCAGCAACAACAAAGGAGCGGGTATGG
AATCACGGCATGATTTGCTCGCTAAAAAGCGCAAGCTTTCTAGACCAT

BO26886.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
cpo-RS 2909 CG43738-PS 2247..2862 16..631 3080 100 Plus
cpo-RQ 2289 CG43738-PQ 2208..2289 632..713 410 100 Plus
cpo-RS 2909 CG43738-PS 2863..2906 687..730 220 100 Plus
cpo-RP 2526 CG43738-PP 2208..2251 687..730 220 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
cpo-RR 7247 CG43738-RR 3945..4659 16..730 3575 100 Plus
cpo-RY 6131 CG43738-RY 2831..3543 16..730 3510 99.7 Plus
cpo-RX 6116 CG43738-RX 2869..3484 16..631 3080 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18011098..18011713 16..631 3080 100 Plus
3R 32079331 3R 18013148..18013191 687..730 220 100 Plus
Blast to na_te.dros performed 2014-11-28 08:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2987 20..655 318 56.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2363..2971 20..618 312 56.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2740..2984 437..686 282 62 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2766..2990 393..619 275 61 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2923 49..688 254 54.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2781..2959 371..557 248 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..7210 20..501 202 56.7 Plus
I-element 5371 I-element DMIFACA 5371bp Derived from M14954 (g157749) (Rel. 44, Last updated, Version 2). 1124..1244 567..685 193 66.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6835..6934 20..121 162 67.3 Plus
roo 9092 roo DM_ROO 9092bp 1069..1164 20..114 161 67 Plus
roo 9092 roo DM_ROO 9092bp 1093..1163 20..91 159 70.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6763..6836 20..91 158 70.3 Plus
roo 9092 roo DM_ROO 9092bp 1079..1151 21..91 153 71.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6737..6802 46..112 152 73.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2762..2853 20..110 150 66.7 Plus
roo 9092 roo DM_ROO 9092bp 1037..1141 10..112 150 62.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6723..7212 53..559 146 54.3 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3270..3344 36..112 146 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6817..6887 20..91 141 68.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6857 20..91 140 67.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2603..3005 20..460 136 53.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2798..2889 20..110 133 64.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1520..1584 20..82 131 69.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1518..1584 24..91 130 67.6 Plus
roo 9092 roo DM_ROO 9092bp 1052..1129 38..112 120 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1516..1589 44..118 111 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2764..2828 47..112 111 67.2 Plus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 662..727 104..38 107 64.2 Minus

BO26886.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:53:30 Download gff for BO26886.complete
Subject Subject Range Query Range Percent Splice Strand
CG42457-RA 2758..3471 17..732 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:58 Download gff for BO26886.complete
Subject Subject Range Query Range Percent Splice Strand
cpo-RN 2832..3545 17..732 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:28:29 Download gff for BO26886.complete
Subject Subject Range Query Range Percent Splice Strand
cpo-RR 3946..4659 17..732 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:28:29 Download gff for BO26886.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18011099..18011713 17..631 100 -> Plus
3R 18012096..18012150 632..686 100 -> Plus
3R 18013148..18013191 687..732 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:58 Download gff for BO26886.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13837818..13837872 632..686 100 -> Plus
arm_3R 13838870..13838913 687..732 95   Plus
arm_3R 13836821..13837435 17..631 100 -> Plus

BO26886.pep Sequence

Translation from 16 to 748

> BO26886.pep
MATATGSSCSTSNGSGSSSNSNHNSAAVQQHPVAFIEFKDPPTASQAMQQ
LQGKYLLSSDRGSIRIEFARSKMINEVTIMNTKAPPPPPPTAVAATVAPP
PPPAPMYILNGGGGVEHLLVPAPPPSAQQQQQQQQQQLQMQQLQQQMHLQ
QQHQQQQQLQLTVAAPCTAASTTTHSSTTSVVVNSLQHHQLHHPNQHHQN
HLFRDQQQQHQQQATIKQQSATTKERVWNHGMICSLKSASFLDH

BO26886.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
cpo-PS 962 CG43738-PS 750..955 1..206 1073 99.5 Plus
velo-PC 1833 CG10107-PC 50..153 91..227 164 36.7 Plus
velo-PA 1833 CG10107-PA 50..153 91..227 164 36.7 Plus
ct-PD 2165 CG11387-PD 565..706 95..231 163 33.1 Plus
ct-PC 2383 CG11387-PC 783..924 95..231 163 33.1 Plus