Clone BO26902 Report

Search the DGRC for BO26902

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:2
Vector:pDNR-Dual
Associated Gene/TranscriptCG18371-RA
Protein status:BO26902.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO26902.complete Sequence

364 bp assembled on 2010-07-02

GenBank Submission: KX795320

> BO26902.complete
GAAGTTATCAGTCGACATGATGCAGCCAGCGGAACAGATCTTCTCCTGCG
GATTCGAACTCTTCGGGCGAGTACAGGGTGTGTGTTTGCGGAAGCAGACA
CGAGATCTGGCCACAATGAACCAGGTGCGCGGGTGGGTGATGAACACGGA
CGAGGGCACGGTGAAGGGACAGCTGGAGGGCACACTGCCCAAGGTCAACG
TGCTGAAGTTCTGGCTACTGAATATCGGCAGTCCGCGCTCGATTATCGAG
CGGGCGGAATTCACGCCCACCAAGGAGATCACTTCGCACAACTTTAGCCG
ATTCTCGATTCGCTACCACAATGTGGCAGCAACGAAAAAGGCCATTGCAA
GCTTTCTAGACCAT

BO26902.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-RA 333 CG18371-PA 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-RA 477 CG18371-RA 115..444 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:12:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14028734..14029063 17..346 1650 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:12:53 has no hits.

BO26902.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:49 Download gff for BO26902.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 117..446 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:13:48 Download gff for BO26902.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 115..444 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:24:20 Download gff for BO26902.complete
Subject Subject Range Query Range Percent Splice Strand
CG18371-RA 115..444 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:24:20 Download gff for BO26902.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14028734..14029063 17..348 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:13:48 Download gff for BO26902.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9916239..9916568 17..348 99   Plus

BO26902.pep Sequence

Translation from 16 to 364

> BO26902.pep
MMQPAEQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVK
GQLEGTLPKVNVLKFWLLNIGSPRSIIERAEFTPTKEITSHNFSRFSIRY
HNVAATKKAIASFLDH

BO26902.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG18371-PA 110 CG18371-PA 1..110 1..110 574 100 Plus
CG34161-PC 125 CG34161-PC 32..124 7..99 250 51.6 Plus
CG34161-PA 125 CG34161-PA 32..124 7..99 250 51.6 Plus
CG34161-PB 120 CG34161-PB 32..119 7..99 231 50.5 Plus
Acyp2-PB 102 CG18505-PB 7..102 5..100 222 46.9 Plus