Clone BO26906 Report

Search the DGRC for BO26906

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:6
Vector:pDNR-Dual
Associated Gene/TranscriptCG13427-RA
Protein status:BO26906.pep: Imported from assembly
Sequenced Size:349

Clone Sequence Records

BO26906.complete Sequence

349 bp assembled on 2010-07-02

GenBank Submission: KX793877

> BO26906.complete
GAAGTTATCAGTCGACATGAAGTTCGTGGCCATTCTTCTGCTGAGCAGCC
TCACCATTGCGATGGTTTTGGCATTTCCTGATAACGACGATAAAAATGTT
CTTGTGCCAGCTGATATGCAGCATGTTGCTCCACTGGCCGCAGCAGCAGA
TCCCCCGACGTCGGCAGACCAAGTCTCTAACAGCATACGCGGTCCACGCC
ATCTCCTGAGCAAATTGTTCCAGCCCAAGACCGTGGTGGTGCAGCCAGTG
ATTGTGGAGCAGGTGGCTCCAAGACAGTACCCCGGATACGCACAGCCCTA
TCCGTACTACAACCAGGGCCGACGCTACTGGGCAAGCTTTCTAGACCAT

BO26906.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13427-RA 318 CG13427-PA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13427-RA 440 CG13427-RA 47..366 12..331 1585 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:12:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20538951..20539270 331..12 1585 99.7 Minus
Blast to na_te.dros performed on 2014-11-28 02:12:24 has no hits.

BO26906.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:46 Download gff for BO26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13427-RA 50..364 17..333 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:13:37 Download gff for BO26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13427-RA 52..366 17..333 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:24:09 Download gff for BO26906.complete
Subject Subject Range Query Range Percent Splice Strand
CG13427-RA 52..366 17..333 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:24:09 Download gff for BO26906.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20538949..20539265 17..333 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:13:37 Download gff for BO26906.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16426454..16426770 17..333 99   Minus

BO26906.pep Sequence

Translation from 16 to 349

> BO26906.pep
MKFVAILLLSSLTIAMVLAFPDNDDKNVLVPADMQHVAPLAAAADPPTSA
DQVSNSIRGPRHLLSKLFQPKTVVVQPVIVEQVAPRQYPGYAQPYPYYNQ
GRRYWASFLDH

BO26906.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13427-PA 105 CG13427-PA 1..105 1..105 545 100 Plus