BO26915.complete Sequence
346 bp assembled on 2010-07-02
GenBank Submission: KX795201
> BO26915.complete
GAAGTTATCAGTCGACATGGCAGACGAGGAGGCCGGCAAGGAGGGCGAGA
AGAAAATCGTGCACGTTTATCCTCTGGTTAAGCACACCGATATGAACGAG
GAGATGCGGATAGAGGCCATTGAACTGTCCATTACCGCCTGCGAGAAATA
CTCATCGAACTACGAGCACGCTGCCAAAATCATCAAGGAGAACATGGACA
AGAAGTTCGGCATCTACTGGCATGTGGTCGTGGGCGAAGGGTTCGGCTTT
GAGGTCTCCTACGAGACGGAGAACATTCTTTATCTGTTCTTCGCCGGCAA
CCTGGCCATCGTGCTGTGGAAGTGCTCCGCAAGCTTTCTAGACCAT
BO26915.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:11:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8407-RB | 315 | CG8407-PB | 1..312 | 17..328 | 1560 | 100 | Plus |
| CG8407-RA | 315 | CG8407-PA | 1..312 | 17..328 | 1560 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:11:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8407-RB | 728 | CG8407-RB | 218..532 | 14..328 | 1575 | 100 | Plus |
| CG8407-RA | 612 | CG8407-RA | 102..416 | 14..328 | 1575 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:11:50
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 12153904..12154067 | 165..328 | 820 | 100 | Plus |
| 2R | 25286936 | 2R | 12153640..12153728 | 78..166 | 445 | 100 | Plus |
| 2R | 25286936 | 2R | 12153510..12153578 | 14..82 | 345 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:11:50 has no hits.
BO26915.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:43 Download gff for
BO26915.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8407-RA | 53..364 | 17..330 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:13:22 Download gff for
BO26915.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8407-RA | 105..416 | 17..330 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:23:57 Download gff for
BO26915.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG8407-RA | 105..416 | 17..330 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:23:57 Download gff for
BO26915.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 12153513..12153578 | 17..82 | 100 | -> | Plus |
| 2R | 12153645..12153728 | 83..166 | 100 | -> | Plus |
| 2R | 12153906..12154067 | 167..330 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:13:22 Download gff for
BO26915.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 8041018..8041083 | 17..82 | 100 | -> | Plus |
| arm_2R | 8041150..8041233 | 83..166 | 100 | -> | Plus |
| arm_2R | 8041411..8041572 | 167..330 | 98 | | Plus |
BO26915.pep Sequence
Translation from 16 to 346
> BO26915.pep
MADEEAGKEGEKKIVHVYPLVKHTDMNEEMRIEAIELSITACEKYSSNYE
HAAKIIKENMDKKFGIYWHVVVGEGFGFEVSYETENILYLFFAGNLAIVL
WKCSASFLDH
BO26915.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG8407-PA | 104 | CG8407-PA | 1..104 | 1..104 | 550 | 100 | Plus |
| CG8407-PB | 104 | CG8407-PB | 1..104 | 1..104 | 550 | 100 | Plus |
| Cdlc2-PC | 89 | CG5450-PC | 7..87 | 20..102 | 168 | 41 | Plus |
| Cdlc2-PB | 89 | CG5450-PB | 7..87 | 20..102 | 168 | 41 | Plus |
| Cdlc2-PA | 89 | CG5450-PA | 7..87 | 20..102 | 168 | 41 | Plus |
