Clone BO26939 Report

Search the DGRC for BO26939

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:39
Vector:pDNR-Dual
Associated Gene/Transcriptsun-RB
Protein status:BO26939.pep: Imported from assembly
Sequenced Size:205

Clone Sequence Records

BO26939.complete Sequence

205 bp assembled on 2010-07-02

GenBank Submission: KX798703

> BO26939.complete
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCATGAAAGGGCTGCAAGCTTTCTAG
ACCAT

BO26939.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RB 174 CG9032-PB 1..171 17..187 855 100 Plus
sun-RA 186 CG9032-PA 1..161 17..177 805 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:10:02
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RB 450 CG9032-RB 95..265 17..187 855 100 Plus
sun-RA 400 CG9032-RA 95..255 17..177 805 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15848886..15849016 176..46 655 100 Minus
3R 32079331 3R 10122032..10122180 23..171 190 75.2 Plus
Blast to na_te.dros performed on 2014-11-28 02:10:00 has no hits.

BO26939.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:28 Download gff for BO26939.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RB 77..247 17..189 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:12:31 Download gff for BO26939.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RB 95..265 17..189 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:23:16 Download gff for BO26939.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RB 95..265 17..189 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:23:16 Download gff for BO26939.complete
Subject Subject Range Query Range Percent Splice Strand
X 15848886..15849016 46..176 100 <- Minus
X 15849136..15849164 17..45 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:12:31 Download gff for BO26939.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15742919..15743049 46..176 100 <- Minus
arm_X 15743169..15743197 17..45 100   Minus

BO26939.pep Sequence

Translation from 16 to 205

> BO26939.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAHERAASFLDH

BO26939.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
sun-PB 57 CG9032-PB 1..57 1..57 296 100 Plus
sun-PA 61 CG9032-PA 1..59 1..59 278 91.5 Plus
CG31477-PC 64 CG31477-PC 1..52 1..52 215 76.9 Plus
CG31477-PB 64 CG31477-PB 1..52 1..52 215 76.9 Plus
CG31477-PA 64 CG31477-PA 1..52 1..52 215 76.9 Plus