BO26939.complete Sequence
205 bp assembled on 2010-07-02
GenBank Submission: KX798703
> BO26939.complete
GAAGTTATCAGTCGACATGACTGCCTGGAGAGCTGCCGGAATTACCTACA
TCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACG
GGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGTTCAC
TCCCTGGGCAAATGGCAAGCCAGCTCATGAAAGGGCTGCAAGCTTTCTAG
ACCAT
BO26939.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:10:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-RB | 174 | CG9032-PB | 1..171 | 17..187 | 855 | 100 | Plus |
sun-RA | 186 | CG9032-PA | 1..161 | 17..177 | 805 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:10:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-RB | 450 | CG9032-RB | 95..265 | 17..187 | 855 | 100 | Plus |
sun-RA | 400 | CG9032-RA | 95..255 | 17..177 | 805 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:09:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 15848886..15849016 | 176..46 | 655 | 100 | Minus |
3R | 32079331 | 3R | 10122032..10122180 | 23..171 | 190 | 75.2 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:10:00 has no hits.
BO26939.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:28 Download gff for
BO26939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RB | 77..247 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:12:31 Download gff for
BO26939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RB | 95..265 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:23:16 Download gff for
BO26939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
sun-RB | 95..265 | 17..189 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:23:16 Download gff for
BO26939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 15848886..15849016 | 46..176 | 100 | <- | Minus |
X | 15849136..15849164 | 17..45 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:12:31 Download gff for
BO26939.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 15742919..15743049 | 46..176 | 100 | <- | Minus |
arm_X | 15743169..15743197 | 17..45 | 100 | | Minus |
BO26939.pep Sequence
Translation from 16 to 205
> BO26939.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAHERAASFLDH
BO26939.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:30:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
sun-PB | 57 | CG9032-PB | 1..57 | 1..57 | 296 | 100 | Plus |
sun-PA | 61 | CG9032-PA | 1..59 | 1..59 | 278 | 91.5 | Plus |
CG31477-PC | 64 | CG31477-PC | 1..52 | 1..52 | 215 | 76.9 | Plus |
CG31477-PB | 64 | CG31477-PB | 1..52 | 1..52 | 215 | 76.9 | Plus |
CG31477-PA | 64 | CG31477-PA | 1..52 | 1..52 | 215 | 76.9 | Plus |