Clone BO26950 Report

Search the DGRC for BO26950

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG34210-RA
Protein status:BO26950.pep: Inserted from web
Sequenced Size:316

Clone Sequence Records

BO26950.complete Sequence

316 bp assembled on 2010-07-02

GenBank Submission: KX798759

> BO26950.complete
GAAGTTATCAGTCGACATGAAGAAGTCCGGGGACTTTCTCTCCCTGCTCA
ACAATCGCGACCTGCTGAAGACTCCGTCCGGCAACTCCATTGTGAACTTC
CTGGTGAAACCGATGAGCGTGGAAATGAACACGGCGGACAATCTGATCAC
GGGTGCCAGGCGCCAGCGAATGATGGAGCTCTTCCAGGAGGACCGCGCCT
GGGAGGCCGCCGAGTTGTCCCGCTTCGGACTGAGCTGCATCAAGGCCCCG
GACTGCTATCCCTGCTGCACTCCTTTCGAGTGCTCCAAGGCCAAGTTCGC
AAGCTTTCTAGACCAT

BO26950.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-RA 285 CG34210-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-RA 565 CG34210-RA 106..387 17..298 1410 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:13:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23351705..23351966 37..298 1310 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:13:41 has no hits.

BO26950.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:03 Download gff for BO26950.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 40..321 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:14:09 Download gff for BO26950.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 106..387 17..300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:24:40 Download gff for BO26950.complete
Subject Subject Range Query Range Percent Splice Strand
CG34210-RA 106..387 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:24:40 Download gff for BO26950.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23351623..23351642 17..36 100 -> Plus
2R 23351705..23351966 37..300 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:14:09 Download gff for BO26950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19239146..19239165 17..36 100 -> Plus
arm_2R 19239228..19239489 37..300 99   Plus

BO26950.pep Sequence

Translation from 16 to 316

> BO26950.pep
MKKSGDFLSLLNNRDLLKTPSGNSIVNFLVKPMSVEMNTADNLITGARRQ
RMMELFQEDRAWEAAELSRFGLSCIKAPDCYPCCTPFECSKAKFASFLDH

BO26950.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34210-PA 94 CG34210-PA 1..94 1..94 498 100 Plus