BO26951.complete Sequence
208 bp assembled on 2010-07-02
GenBank Submission: KX796867
> BO26951.complete
GAAGTTATCAGTCGACATGGCAGTCCTGCGTGGTTGGAGATTCGTTGGAT
TCGTGTCCTGCATCGTGGGCGCCGTGGGCCTCACCCTATACCCCGTCATT
GTGGACCCCATGGTTAACACTGAGAAATACAAAACCCTGCAGGAATACAG
CAAAATCAAGAGAGATGAACTGCAGCACATTAAAAGGCAGGCAAGCTTTC
TAGACCAT
BO26951.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:09:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-RB | 177 | CG34242-PB | 1..174 | 17..190 | 870 | 100 | Plus |
CG34242-RA | 177 | CG34242-PA | 1..174 | 17..190 | 870 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:09:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-RB | 343 | CG34242-RB | 14..187 | 17..190 | 870 | 100 | Plus |
CG34242-RA | 366 | CG34242-RA | 30..203 | 17..190 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:09:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 12534067..12534240 | 17..190 | 870 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:09:17 has no hits.
BO26951.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:21 Download gff for
BO26951.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 30..203 | 17..192 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:12:11 Download gff for
BO26951.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 30..203 | 17..192 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:59 Download gff for
BO26951.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34242-RA | 30..203 | 17..192 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:59 Download gff for
BO26951.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 12534067..12534240 | 17..192 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:12:11 Download gff for
BO26951.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 12527167..12527340 | 17..192 | 98 | | Plus |
BO26951.pep Sequence
Translation from 16 to 208
> BO26951.pep
MAVLRGWRFVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSKIKRD
ELQHIKRQASFLDH
BO26951.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:29:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34242-PB | 58 | CG34242-PB | 1..58 | 1..58 | 301 | 100 | Plus |
CG34242-PA | 58 | CG34242-PA | 1..58 | 1..58 | 301 | 100 | Plus |