Clone BO26951 Report

Search the DGRC for BO26951

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG34242-RA
Protein status:BO26951.pep: Imported from assembly
Sequenced Size:208

Clone Sequence Records

BO26951.complete Sequence

208 bp assembled on 2010-07-02

GenBank Submission: KX796867

> BO26951.complete
GAAGTTATCAGTCGACATGGCAGTCCTGCGTGGTTGGAGATTCGTTGGAT
TCGTGTCCTGCATCGTGGGCGCCGTGGGCCTCACCCTATACCCCGTCATT
GTGGACCCCATGGTTAACACTGAGAAATACAAAACCCTGCAGGAATACAG
CAAAATCAAGAGAGATGAACTGCAGCACATTAAAAGGCAGGCAAGCTTTC
TAGACCAT

BO26951.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-RB 177 CG34242-PB 1..174 17..190 870 100 Plus
CG34242-RA 177 CG34242-PA 1..174 17..190 870 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:09:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-RB 343 CG34242-RB 14..187 17..190 870 100 Plus
CG34242-RA 366 CG34242-RA 30..203 17..190 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12534067..12534240 17..190 870 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:09:17 has no hits.

BO26951.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:21 Download gff for BO26951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 30..203 17..192 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:12:11 Download gff for BO26951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 30..203 17..192 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:59 Download gff for BO26951.complete
Subject Subject Range Query Range Percent Splice Strand
CG34242-RA 30..203 17..192 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:59 Download gff for BO26951.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12534067..12534240 17..192 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:12:11 Download gff for BO26951.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12527167..12527340 17..192 98   Plus

BO26951.pep Sequence

Translation from 16 to 208

> BO26951.pep
MAVLRGWRFVGFVSCIVGAVGLTLYPVIVDPMVNTEKYKTLQEYSKIKRD
ELQHIKRQASFLDH

BO26951.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34242-PB 58 CG34242-PB 1..58 1..58 301 100 Plus
CG34242-PA 58 CG34242-PA 1..58 1..58 301 100 Plus