Clone BO26953 Report

Search the DGRC for BO26953

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:53
Vector:pDNR-Dual
Associated Gene/TranscriptCG11741-RA
Protein status:BO26953.pep: Inserted from web
Sequenced Size:235

Clone Sequence Records

BO26953.complete Sequence

235 bp assembled on 2010-07-02

GenBank Submission: KX796368

> BO26953.complete
GAAGTTATCAGTCGACATGACGTCTCCCTTCGACGGCATTGCCTGCTTCT
GGCTGTCACTAGTCTGGATTCAACTGGGTATCATCAATGCCGGCCTGGAG
TTCCTCAAGGATTTCGTACCCCTTCAGCTGGTGCGGCTGAGAGAGATCGA
GGACGAAGAGCGGGAAATCGAGGGCGAGTGCACCCTGGGAGCCATCAGCA
TTCGTATGTTCGCCTTTGCAAGCTTTCTAGACCAT

BO26953.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:13:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-RB 204 CG11741-PB 1..201 17..217 1005 100 Plus
CG11741-RA 204 CG11741-PA 1..201 17..217 1005 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:13:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-RB 356 CG11741-RB 15..215 17..217 1005 100 Plus
CG11741-RA 455 CG11741-RA 15..215 17..217 1005 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8528663..8528863 217..17 1005 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:13:31 has no hits.

BO26953.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:02 Download gff for BO26953.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 15..215 17..219 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:14:06 Download gff for BO26953.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 15..215 17..219 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:24:36 Download gff for BO26953.complete
Subject Subject Range Query Range Percent Splice Strand
CG11741-RA 15..215 17..219 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:24:36 Download gff for BO26953.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8528661..8528863 17..219 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:14:06 Download gff for BO26953.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4354383..4354585 17..219 99   Minus

BO26953.pep Sequence

Translation from 16 to 235

> BO26953.pep
MTSPFDGIACFWLSLVWIQLGIINAGLEFLKDFVPLQLVRLREIEDEERE
IEGECTLGAISIRMFAFASFLDH

BO26953.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11741-PB 67 CG11741-PB 1..67 1..67 347 100 Plus
CG11741-PA 67 CG11741-PA 1..67 1..67 347 100 Plus