BO26953.complete Sequence
235 bp assembled on 2010-07-02
GenBank Submission: KX796368
> BO26953.complete
GAAGTTATCAGTCGACATGACGTCTCCCTTCGACGGCATTGCCTGCTTCT
GGCTGTCACTAGTCTGGATTCAACTGGGTATCATCAATGCCGGCCTGGAG
TTCCTCAAGGATTTCGTACCCCTTCAGCTGGTGCGGCTGAGAGAGATCGA
GGACGAAGAGCGGGAAATCGAGGGCGAGTGCACCCTGGGAGCCATCAGCA
TTCGTATGTTCGCCTTTGCAAGCTTTCTAGACCAT
BO26953.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:13:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-RB | 204 | CG11741-PB | 1..201 | 17..217 | 1005 | 100 | Plus |
CG11741-RA | 204 | CG11741-PA | 1..201 | 17..217 | 1005 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:13:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-RB | 356 | CG11741-RB | 15..215 | 17..217 | 1005 | 100 | Plus |
CG11741-RA | 455 | CG11741-RA | 15..215 | 17..217 | 1005 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:13:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 8528663..8528863 | 217..17 | 1005 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:13:31 has no hits.
BO26953.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:02 Download gff for
BO26953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 15..215 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:14:06 Download gff for
BO26953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 15..215 | 17..219 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:24:36 Download gff for
BO26953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11741-RA | 15..215 | 17..219 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:24:36 Download gff for
BO26953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 8528661..8528863 | 17..219 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:14:06 Download gff for
BO26953.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 4354383..4354585 | 17..219 | 99 | | Minus |
BO26953.pep Sequence
Translation from 16 to 235
> BO26953.pep
MTSPFDGIACFWLSLVWIQLGIINAGLEFLKDFVPLQLVRLREIEDEERE
IEGECTLGAISIRMFAFASFLDH
BO26953.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11741-PB | 67 | CG11741-PB | 1..67 | 1..67 | 347 | 100 | Plus |
CG11741-PA | 67 | CG11741-PA | 1..67 | 1..67 | 347 | 100 | Plus |