BO26954.complete Sequence
283 bp assembled on 2012-04-24
GenBank Submission: KX798372
> BO26954.complete
GAAGTTATCAGTCGACATGCCGGTGGCTGTACGTCTAGTAGAGGTCTTGA
CCCTGATCACCATTATGGGTCTAATTACATGCATTGGTCTCAGCGTGATT
TTGGCCCAAAAGACACTCAGTATGACAATAACATTTCTCGAGCCCGCAGC
GAATATTGCCAATATGGTGCTAGTTGTAACCGAGAAAATACTGGTGTCCT
CGCTGCTCTGCGTTTTGAGTCTCACAAATGCGGTGGGAAATGCCCTGCAT
GTGGCTGGAATCGCCGCAAGCTTTCTAGACCAT
BO26954.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:49:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34204-RA | 252 | CG34204-PA | 1..249 | 17..265 | 1245 | 100 | Plus |
| CG34204-RB | 150 | CG34204-PB | 1..150 | 17..173 | 645 | 95.5 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:49:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34204-RA | 486 | CG34204-RA | 146..394 | 17..265 | 1245 | 100 | Plus |
| CG34204-RB | 479 | CG34204-RB | 146..387 | 17..265 | 1105 | 97.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:49:51
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 21796540..21796665 | 17..142 | 630 | 100 | Plus |
| 2R | 25286936 | 2R | 21796725..21796849 | 141..265 | 625 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 05:49:52 has no hits.
BO26954.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-06 12:07:10 Download gff for
BO26954.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34204-RA | 1..249 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:01:40 Download gff for
BO26954.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34204-RA | 90..338 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:41 Download gff for
BO26954.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34204-RA | 146..394 | 17..267 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:19:18 Download gff for
BO26954.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34204-RA | 146..394 | 17..267 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:19:18 Download gff for
BO26954.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 21796540..21796665 | 17..142 | 100 | -> | Plus |
| 2R | 21796727..21796849 | 143..267 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:41 Download gff for
BO26954.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 17684045..17684170 | 17..142 | 100 | -> | Plus |
| arm_2R | 17684232..17684354 | 143..267 | 98 | | Plus |
BO26954.pep Sequence
Translation from 16 to 283
> BO26954.pep
MPVAVRLVEVLTLITIMGLITCIGLSVILAQKTLSMTITFLEPAANIANM
VLVVTEKILVSSLLCVLSLTNAVGNALHVAGIAASFLDH
BO26954.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34204-PA | 83 | CG34204-PA | 1..83 | 1..83 | 389 | 100 | Plus |
| CG34204-PB | 49 | CG34204-PB | 1..42 | 1..42 | 196 | 100 | Plus |
