Clone BO26965 Report

Search the DGRC for BO26965

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG13068-RA
Protein status:BO26965.pep: Imported from assembly
Sequenced Size:361

Clone Sequence Records

BO26965.complete Sequence

361 bp assembled on 2010-07-02

GenBank Submission: KX794708

> BO26965.complete
GAAGTTATCAGTCGACATGTTCAAGCTGTCTGCCCTCGTTGTCCTGTGCG
CTCTGGTGGCCTGCTCCTCGGCTGAGCCCAAGCCCGCTATCCTGGCCGCC
GCTCCAGTGGTTGCAGCTGCTCCTGCCGGCGTGGTCACCGCTACCAGTTC
GCAGTACGTGGCCCGCAACTTCAACGGTGTGGCTGCTGCTCCAGTTGTTG
CCGCTGCCTACACCGCTCCAGTTGCCGCCGCTGCCTATACCGCTCCAGTT
GCCGCCGCTGCTTATACCGCTCCAGTTGCCGCTGCCTACTCTGCTTATCC
GTATGCCGCCTACCCTTACAGCGCTGCATACACCACTGTTTTGGCAAGCT
TTCTAGACCAT

BO26965.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-RA 330 CG13068-PA 1..327 17..343 1635 100 Plus
CG13068-RA 330 CG13068-PA 172..239 215..282 280 94.1 Plus
CG13068-RA 330 CG13068-PA 199..266 188..255 280 94.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-RA 450 CG13068-RA 43..370 16..343 1640 100 Plus
CG13068-RA 450 CG13068-RA 215..282 215..282 280 94.1 Plus
CG13068-RA 450 CG13068-RA 242..309 188..255 280 94.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:08:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16269516..16269831 28..343 1580 100 Plus
3L 28110227 3L 16269676..16269743 215..282 280 94.1 Plus
3L 28110227 3L 16269703..16269770 188..255 280 94.1 Plus
Blast to na_te.dros performed 2014-11-28 02:08:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2434..2539 283..178 134 62.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2747..2799 228..176 103 66 Minus

BO26965.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:05 Download gff for BO26965.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 50..371 22..345 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:11:38 Download gff for BO26965.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 49..370 22..345 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:33 Download gff for BO26965.complete
Subject Subject Range Query Range Percent Splice Strand
CG13068-RA 49..370 22..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:33 Download gff for BO26965.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16269510..16269831 22..345 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:11:38 Download gff for BO26965.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16262610..16262931 22..345 98   Plus

BO26965.pep Sequence

Translation from 16 to 361

> BO26965.pep
MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTATSSQYVAR
NFNGVAAAPVVAAAYTAPVAAAAYTAPVAAAAYTAPVAAAYSAYPYAAYP
YSAAYTTVLASFLDH

BO26965.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG13068-PA 109 CG13068-PA 1..109 1..109 531 100 Plus
CG18294-PA 141 CG18294-PA 1..130 1..110 209 47.4 Plus
825-Oak-PB 129 CG32208-PB 1..113 1..110 203 48.3 Plus
CG32213-PB 129 CG32213-PB 1..113 1..110 200 47.5 Plus
CG12519-PB 131 CG12519-PB 1..115 1..110 196 46 Plus