BO26965.complete Sequence
361 bp assembled on 2010-07-02
GenBank Submission: KX794708
> BO26965.complete
GAAGTTATCAGTCGACATGTTCAAGCTGTCTGCCCTCGTTGTCCTGTGCG
CTCTGGTGGCCTGCTCCTCGGCTGAGCCCAAGCCCGCTATCCTGGCCGCC
GCTCCAGTGGTTGCAGCTGCTCCTGCCGGCGTGGTCACCGCTACCAGTTC
GCAGTACGTGGCCCGCAACTTCAACGGTGTGGCTGCTGCTCCAGTTGTTG
CCGCTGCCTACACCGCTCCAGTTGCCGCCGCTGCCTATACCGCTCCAGTT
GCCGCCGCTGCTTATACCGCTCCAGTTGCCGCTGCCTACTCTGCTTATCC
GTATGCCGCCTACCCTTACAGCGCTGCATACACCACTGTTTTGGCAAGCT
TTCTAGACCAT
BO26965.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:08:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13068-RA | 330 | CG13068-PA | 1..327 | 17..343 | 1635 | 100 | Plus |
CG13068-RA | 330 | CG13068-PA | 172..239 | 215..282 | 280 | 94.1 | Plus |
CG13068-RA | 330 | CG13068-PA | 199..266 | 188..255 | 280 | 94.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:08:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13068-RA | 450 | CG13068-RA | 43..370 | 16..343 | 1640 | 100 | Plus |
CG13068-RA | 450 | CG13068-RA | 215..282 | 215..282 | 280 | 94.1 | Plus |
CG13068-RA | 450 | CG13068-RA | 242..309 | 188..255 | 280 | 94.1 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:08:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16269516..16269831 | 28..343 | 1580 | 100 | Plus |
3L | 28110227 | 3L | 16269676..16269743 | 215..282 | 280 | 94.1 | Plus |
3L | 28110227 | 3L | 16269703..16269770 | 188..255 | 280 | 94.1 | Plus |
Blast to na_te.dros performed 2014-11-28 02:08:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2434..2539 | 283..178 | 134 | 62.4 | Minus |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2747..2799 | 228..176 | 103 | 66 | Minus |
BO26965.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:02:05 Download gff for
BO26965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13068-RA | 50..371 | 22..345 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:11:38 Download gff for
BO26965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13068-RA | 49..370 | 22..345 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:33 Download gff for
BO26965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13068-RA | 49..370 | 22..345 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:33 Download gff for
BO26965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16269510..16269831 | 22..345 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:11:38 Download gff for
BO26965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16262610..16262931 | 22..345 | 98 | | Plus |
BO26965.pep Sequence
Translation from 16 to 361
> BO26965.pep
MFKLSALVVLCALVACSSAEPKPAILAAAPVVAAAPAGVVTATSSQYVAR
NFNGVAAAPVVAAAYTAPVAAAAYTAPVAAAAYTAPVAAAYSAYPYAAYP
YSAAYTTVLASFLDH
BO26965.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13068-PA | 109 | CG13068-PA | 1..109 | 1..109 | 531 | 100 | Plus |
CG18294-PA | 141 | CG18294-PA | 1..130 | 1..110 | 209 | 47.4 | Plus |
825-Oak-PB | 129 | CG32208-PB | 1..113 | 1..110 | 203 | 48.3 | Plus |
CG32213-PB | 129 | CG32213-PB | 1..113 | 1..110 | 200 | 47.5 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..115 | 1..110 | 196 | 46 | Plus |