Clone BO26969 Report

Search the DGRC for BO26969

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptIlp6-RA
Protein status:BO26969.pep: Imported from assembly
Sequenced Size:355

Clone Sequence Records

BO26969.complete Sequence

355 bp assembled on 2012-04-24

GenBank Submission: KX795871

> BO26969.complete
GAAGTTATCAGTCGACATGGTTCTCAAAGTGCCGACGTCCAAAGTCCTGC
TAGTCCTGGCCACCTTGTTCGCCGTGGCGGCGATGATCAGCAGCTGGATG
CCCCAGGTGGCGGCCAGTCCGCTCGCACCCACGGAATACGAACAGAGACG
CATGATGTGCTCCACCGGCCTCAGCGATGTGATACAGAAGATATGCGTAA
GCGGAACGGTGGCCCTTGGCGATGTATTTCCCAACAGTTTCGGGAAGCGC
AGGAAGCGCGACTTGCAGAACGTAACCGATTTGTGCTGCAAGTCGGGTGG
CTGCACCTACAGGGAGCTCTTGCAGTACTGCAAAGGAGCAAGCTTTCTAG
ACCAT

BO26969.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp6-RD 324 CG14049-PD 1..321 17..337 1605 100 Plus
Ilp6-RC 324 CG14049-PC 1..321 17..337 1605 100 Plus
Ilp6-RB 324 CG14049-PB 1..321 17..337 1605 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp6-RA 1908 CG14049-RA 1338..1660 15..337 1615 100 Plus
Ilp6-RD 702 CG14049-RD 134..454 17..337 1605 100 Plus
Ilp6-RC 941 CG14049-RC 373..693 17..337 1605 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2331926..2332139 230..17 1070 100 Minus
X 23542271 X 2331741..2331847 337..231 535 100 Minus
Blast to na_te.dros performed on 2014-11-28 05:49:26 has no hits.

BO26969.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-06 12:07:09 Download gff for BO26969.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 368..688 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:01:40 Download gff for BO26969.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1340..1660 17..339 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:35 Download gff for BO26969.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1340..1660 17..339 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:19:06 Download gff for BO26969.complete
Subject Subject Range Query Range Percent Splice Strand
Ilp6-RA 1340..1660 17..339 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:19:06 Download gff for BO26969.complete
Subject Subject Range Query Range Percent Splice Strand
X 2331739..2331847 231..339 98 <- Minus
X 2331926..2332139 17..230 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:35 Download gff for BO26969.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2225772..2225880 231..339 98 <- Minus
arm_X 2225959..2226172 17..230 100   Minus

BO26969.pep Sequence

Translation from 16 to 355

> BO26969.pep
MVLKVPTSKVLLVLATLFAVAAMISSWMPQVAASPLAPTEYEQRRMMCST
GLSDVIQKICVSGTVALGDVFPNSFGKRRKRDLQNVTDLCCKSGGCTYRE
LLQYCKGASFLDH

BO26969.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
Ilp6-PD 107 CG14049-PD 1..107 1..107 554 100 Plus
Ilp6-PC 107 CG14049-PC 1..107 1..107 554 100 Plus
Ilp6-PB 107 CG14049-PB 1..107 1..107 554 100 Plus
Ilp6-PA 107 CG14049-PA 1..107 1..107 554 100 Plus