Clone BO26974 Report

Search the DGRC for BO26974

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:74
Vector:pDNR-Dual
Associated Gene/Transcriptdro4-RA
Protein status:BO26974.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO26974.complete Sequence

247 bp assembled on 2010-07-02

GenBank Submission: KX800125

> BO26974.complete
GAAGTTATCAGTCGACATGGCTCAAATTAAAGGATTGTTTGCTCTCCTCG
CTGTGGTGACCATTGTCCTAATGGTGGCCAACTCGGCTTCGGCCGTGGAT
TGCCCATCTGGAAGATTCAGTGGTCCTTGCTGGGCCTGGGATGGAGAGCA
GTGCCGTCGCCTCTGCAGGGAGGAAGGACGTGTCAGTGGACACTGCAGTG
CCAGTCTGAAGTGCTGGTGCGAACAATGCGCAAGCTTTCTAGACCAT

BO26974.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl4-RA 216 CG32282-PA 1..213 17..229 1065 100 Plus
Drsl3-RA 216 CG32283-PA 20..207 36..223 445 82.4 Plus
Drsl5-RA 210 CG10812-PA 142..200 164..222 205 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl4-RA 323 CG32282-RA 18..230 17..229 1065 100 Plus
Drsl3-RA 360 CG32283-RA 58..245 36..223 445 82.4 Plus
Drsl5-RA 364 CG10812-RA 196..254 164..222 205 89.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3315637..3315849 17..229 1065 100 Plus
3L 28110227 3L 3315053..3315240 36..223 445 82.4 Plus
3L 28110227 3L 3316976..3317034 164..222 205 89.8 Plus
3L 28110227 3L 3314506..3314578 151..223 200 84.9 Plus
3L 28110227 3L 3369763..3369822 164..223 180 86.7 Plus
Blast to na_te.dros performed 2014-11-28 02:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 3408..3472 159..224 102 63.6 Plus

BO26974.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:38 Download gff for BO26974.complete
Subject Subject Range Query Range Percent Splice Strand
dro4-RA 1..213 17..231 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:11:05 Download gff for BO26974.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl4-RA 18..230 17..231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:01 Download gff for BO26974.complete
Subject Subject Range Query Range Percent Splice Strand
Drsl4-RA 18..230 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:01 Download gff for BO26974.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3315637..3315849 17..231 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:11:05 Download gff for BO26974.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3315637..3315849 17..231 99   Plus

BO26974.pep Sequence

Translation from 16 to 247

> BO26974.pep
MAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLC
REEGRVSGHCSASLKCWCEQCASFLDH

BO26974.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Drsl4-PA 71 CG32282-PA 1..71 1..71 394 100 Plus
Drsl3-PA 71 CG32283-PA 1..71 1..71 280 69 Plus
Drsl2-PA 70 CG32279-PA 1..70 1..71 263 64.8 Plus
Drs-PA 70 CG10810-PA 1..70 1..71 257 66.2 Plus
Drsl5-PA 69 CG10812-PA 2..69 3..71 243 63.8 Plus