Clone BO26978 Report

Search the DGRC for BO26978

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG15210-RA
Protein status:BO26978.pep: Imported from assembly
Sequenced Size:241

Clone Sequence Records

BO26978.complete Sequence

241 bp assembled on 2010-07-02

GenBank Submission: KX799905

> BO26978.complete
GAAGTTATCAGTCGACATGGGAGGCTGTTGCTCAAAGGATTTGGATGACA
AACGCTCGTGGAGTCCCGAGGAGACCAAGAATGGCAGCACCACATCAACA
ATCATTGCCCAGCCGCTGGATGAGGTGGGCACCACCGGTGTCTTCACATT
GACACGCACCACCACTAGCACCACGCGGCAGGAGAAGACGGTGACCACCA
CCAGCGAGGAGCAGGAGCAGGATGCAAGCTTTCTAGACCAT

BO26978.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-RA 210 CG15210-PA 1..207 17..223 1035 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-RA 609 CG15210-RA 158..364 17..223 1035 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10839513..10839650 86..223 690 100 Plus
X 23542271 X 10839387..10839455 17..85 345 100 Plus
Blast to na_te.dros performed 2014-11-28 02:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\TRIM 3111 Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). 2784..2838 67..120 110 69.1 Plus

BO26978.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:31 Download gff for BO26978.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 1..207 17..225 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:10:59 Download gff for BO26978.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 158..364 17..225 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:21:56 Download gff for BO26978.complete
Subject Subject Range Query Range Percent Splice Strand
CG15210-RA 158..364 17..225 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:21:56 Download gff for BO26978.complete
Subject Subject Range Query Range Percent Splice Strand
X 10839387..10839455 17..85 100 -> Plus
X 10839513..10839650 86..225 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:10:59 Download gff for BO26978.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10733420..10733488 17..85 100 -> Plus
arm_X 10733546..10733683 86..225 98   Plus

BO26978.pep Sequence

Translation from 16 to 241

> BO26978.pep
MGGCCSKDLDDKRSWSPEETKNGSTTSTIIAQPLDEVGTTGVFTLTRTTT
STTRQEKTVTTTSEEQEQDASFLDH

BO26978.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15210-PA 69 CG15210-PA 1..69 1..69 359 100 Plus