BO26978.complete Sequence
241 bp assembled on 2010-07-02
GenBank Submission: KX799905
> BO26978.complete
GAAGTTATCAGTCGACATGGGAGGCTGTTGCTCAAAGGATTTGGATGACA
AACGCTCGTGGAGTCCCGAGGAGACCAAGAATGGCAGCACCACATCAACA
ATCATTGCCCAGCCGCTGGATGAGGTGGGCACCACCGGTGTCTTCACATT
GACACGCACCACCACTAGCACCACGCGGCAGGAGAAGACGGTGACCACCA
CCAGCGAGGAGCAGGAGCAGGATGCAAGCTTTCTAGACCAT
BO26978.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15210-RA | 210 | CG15210-PA | 1..207 | 17..223 | 1035 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15210-RA | 609 | CG15210-RA | 158..364 | 17..223 | 1035 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10839513..10839650 | 86..223 | 690 | 100 | Plus |
X | 23542271 | X | 10839387..10839455 | 17..85 | 345 | 100 | Plus |
Blast to na_te.dros performed 2014-11-28 02:06:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmir\TRIM | 3111 | Dmir\TRIM DMTRIM 3126bp Derived from X59239 (Rel. 35, Last updated, Version 3). | 2784..2838 | 67..120 | 110 | 69.1 | Plus |
BO26978.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:31 Download gff for
BO26978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15210-RA | 1..207 | 17..225 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:10:59 Download gff for
BO26978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15210-RA | 158..364 | 17..225 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:21:56 Download gff for
BO26978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15210-RA | 158..364 | 17..225 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:21:56 Download gff for
BO26978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10839387..10839455 | 17..85 | 100 | -> | Plus |
X | 10839513..10839650 | 86..225 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:10:59 Download gff for
BO26978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10733420..10733488 | 17..85 | 100 | -> | Plus |
arm_X | 10733546..10733683 | 86..225 | 98 | | Plus |
BO26978.pep Sequence
Translation from 16 to 241
> BO26978.pep
MGGCCSKDLDDKRSWSPEETKNGSTTSTIIAQPLDEVGTTGVFTLTRTTT
STTRQEKTVTTTSEEQEQDASFLDH
BO26978.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15210-PA | 69 | CG15210-PA | 1..69 | 1..69 | 359 | 100 | Plus |