BO26985.complete Sequence
172 bp assembled on 2010-07-02
GenBank Submission: KX796102
> BO26985.complete
GAAGTTATCAGTCGACATGCTGATCAACCGACATTCCTGTTCGAAACTAC
TTTCTTTGATGGTTTTGCTGTGCTTGGCATTTGACTTAAAACCAGTCTCG
GCGATGAAGTGTCGCCTTGGATTTGTAAAAAGGGGTGGACAATGCACTTG
GCCTGCAAGCTTTCTAGACCAT
BO26985.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-RA | 141 | CG34098-PA | 1..138 | 17..154 | 690 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-RA | 306 | CG34098-RA | 79..216 | 17..154 | 690 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17133523..17133660 | 17..154 | 690 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:06:20 has no hits.
BO26985.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:27 Download gff for
BO26985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 1..138 | 17..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:10:53 Download gff for
BO26985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 66..203 | 17..156 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:21:51 Download gff for
BO26985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp54A1-RA | 79..216 | 17..156 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:21:51 Download gff for
BO26985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17133523..17133660 | 17..156 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:10:53 Download gff for
BO26985.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13021028..13021165 | 17..156 | 98 | | Plus |
BO26985.pep Sequence
Translation from 16 to 172
> BO26985.pep
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWPASFL
DH
BO26985.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:27:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp54A1-PA | 46 | CG34098-PA | 1..46 | 1..46 | 247 | 100 | Plus |