Clone BO26985 Report

Search the DGRC for BO26985

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptAcp54A1-RA
Protein status:BO26985.pep: Imported from assembly
Sequenced Size:172

Clone Sequence Records

BO26985.complete Sequence

172 bp assembled on 2010-07-02

GenBank Submission: KX796102

> BO26985.complete
GAAGTTATCAGTCGACATGCTGATCAACCGACATTCCTGTTCGAAACTAC
TTTCTTTGATGGTTTTGCTGTGCTTGGCATTTGACTTAAAACCAGTCTCG
GCGATGAAGTGTCGCCTTGGATTTGTAAAAAGGGGTGGACAATGCACTTG
GCCTGCAAGCTTTCTAGACCAT

BO26985.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:21
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-RA 141 CG34098-PA 1..138 17..154 690 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-RA 306 CG34098-RA 79..216 17..154 690 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17133523..17133660 17..154 690 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:06:20 has no hits.

BO26985.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:27 Download gff for BO26985.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 1..138 17..156 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:10:53 Download gff for BO26985.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 66..203 17..156 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:21:51 Download gff for BO26985.complete
Subject Subject Range Query Range Percent Splice Strand
Acp54A1-RA 79..216 17..156 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:21:51 Download gff for BO26985.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17133523..17133660 17..156 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:10:53 Download gff for BO26985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13021028..13021165 17..156 98   Plus

BO26985.pep Sequence

Translation from 16 to 172

> BO26985.pep
MLINRHSCSKLLSLMVLLCLAFDLKPVSAMKCRLGFVKRGGQCTWPASFL
DH

BO26985.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
Acp54A1-PA 46 CG34098-PA 1..46 1..46 247 100 Plus