BO26987.complete Sequence
223 bp assembled on 2010-07-02
GenBank Submission: KX794987
> BO26987.complete
GAAGTTATCAGTCGACATGTCCGATCATTTCAACTTCAACGAAGCCTTCA
ACAGCCAGACCATGCGTGGTCGCGCCAATGTAGCCAAGGCCACCTGGGCC
TCGTTGGGACTCGTCTACGTCCTGGTCAAGATGCACCGCCGCAACACGAA
GCGGCGCGAGACCAAGCTCTACTGCAAGGGCTGCCAGCAGGCCATGCTCC
ATGGCGCAAGCTTTCTAGACCAT
BO26987.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15458-RA | 192 | CG15458-PA | 1..189 | 17..205 | 945 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15458-RA | 486 | CG15458-RA | 113..301 | 17..205 | 945 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 20413837..20413962 | 205..80 | 630 | 100 | Minus |
X | 23542271 | X | 20414022..20414087 | 82..17 | 330 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:06:01 has no hits.
BO26987.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:01 Download gff for
BO26987.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15458-RA | 1..189 | 17..207 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:10:46 Download gff for
BO26987.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15458-RA | 113..301 | 17..207 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:21:43 Download gff for
BO26987.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15458-RA | 113..301 | 17..207 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:21:43 Download gff for
BO26987.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20413835..20413962 | 80..207 | 98 | <- | Minus |
X | 20414025..20414087 | 17..79 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:10:46 Download gff for
BO26987.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 20284862..20284989 | 80..207 | 98 | <- | Minus |
arm_X | 20285052..20285114 | 17..79 | 100 | | Minus |
BO26987.pep Sequence
Translation from 16 to 223
> BO26987.pep
MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK
LYCKGCQQAMLHGASFLDH
BO26987.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15458-PA | 63 | CG15458-PA | 1..63 | 1..63 | 337 | 100 | Plus |