Clone BO26987 Report

Search the DGRC for BO26987

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:87
Vector:pDNR-Dual
Associated Gene/TranscriptCG15458-RA
Protein status:BO26987.pep: Inserted from web
Sequenced Size:223

Clone Sequence Records

BO26987.complete Sequence

223 bp assembled on 2010-07-02

GenBank Submission: KX794987

> BO26987.complete
GAAGTTATCAGTCGACATGTCCGATCATTTCAACTTCAACGAAGCCTTCA
ACAGCCAGACCATGCGTGGTCGCGCCAATGTAGCCAAGGCCACCTGGGCC
TCGTTGGGACTCGTCTACGTCCTGGTCAAGATGCACCGCCGCAACACGAA
GCGGCGCGAGACCAAGCTCTACTGCAAGGGCTGCCAGCAGGCCATGCTCC
ATGGCGCAAGCTTTCTAGACCAT

BO26987.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-RA 192 CG15458-PA 1..189 17..205 945 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-RA 486 CG15458-RA 113..301 17..205 945 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20413837..20413962 205..80 630 100 Minus
X 23542271 X 20414022..20414087 82..17 330 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:06:01 has no hits.

BO26987.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:01 Download gff for BO26987.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 1..189 17..207 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:10:46 Download gff for BO26987.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 113..301 17..207 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:21:43 Download gff for BO26987.complete
Subject Subject Range Query Range Percent Splice Strand
CG15458-RA 113..301 17..207 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:21:43 Download gff for BO26987.complete
Subject Subject Range Query Range Percent Splice Strand
X 20413835..20413962 80..207 98 <- Minus
X 20414025..20414087 17..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:10:46 Download gff for BO26987.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20284862..20284989 80..207 98 <- Minus
arm_X 20285052..20285114 17..79 100   Minus

BO26987.pep Sequence

Translation from 16 to 223

> BO26987.pep
MSDHFNFNEAFNSQTMRGRANVAKATWASLGLVYVLVKMHRRNTKRRETK
LYCKGCQQAMLHGASFLDH

BO26987.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15458-PA 63 CG15458-PA 1..63 1..63 337 100 Plus