Clone BO26988 Report

Search the DGRC for BO26988

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:269
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG10039-RB
Protein status:BO26988.pep: Inserted from web
Sequenced Size:259

Clone Sequence Records

BO26988.complete Sequence

259 bp assembled on 2010-07-02

GenBank Submission: KX795766

> BO26988.complete
GAAGTTATCAGTCGACATGTCCGACATCAATATCAACCTCAAGTGCGCCG
AGTGCAACCATCCTCGAGGAGTCCTGTACTATGCAAATCCCCTGGCTTGG
GGCCGTCCTTGTCGCCAGTGCCGCAGGATGATGTCCCGAAATGTTGTGGT
TGTTCCCACTCAGGTTGCAGTTCCAGTTGCTACCAACAACAACATCACCA
CCACTACTACATTTGTACCAGTCGCTGCTGTGTCCACCCAAGCAAGCTTT
CTAGACCAT

BO26988.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-RA 228 CG43773-PA 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-RA 295 CG43773-RA 13..238 16..241 1130 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:43:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4007702..4007927 16..241 1130 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:43:03 has no hits.

BO26988.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:00 Download gff for BO26988.complete
Subject Subject Range Query Range Percent Splice Strand
CG10039-RB 14..238 17..243 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:08 Download gff for BO26988.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 14..238 17..243 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:15:44 Download gff for BO26988.complete
Subject Subject Range Query Range Percent Splice Strand
CG43773-RA 14..238 17..243 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:15:44 Download gff for BO26988.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4007703..4007927 17..243 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:08 Download gff for BO26988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4007703..4007927 17..243 99   Plus

BO26988.pep Sequence

Translation from 16 to 259

> BO26988.pep
MSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRNVVVVPTQV
AVPVATNNNITTTTTFVPVAAVSTQASFLDH

BO26988.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG43773-PA 75 CG43773-PA 1..75 1..75 401 100 Plus
CG43774-PA 95 CG43774-PA 4..68 1..68 215 62 Plus