BO26988.complete Sequence
259 bp assembled on 2010-07-02
GenBank Submission: KX795766
> BO26988.complete
GAAGTTATCAGTCGACATGTCCGACATCAATATCAACCTCAAGTGCGCCG
AGTGCAACCATCCTCGAGGAGTCCTGTACTATGCAAATCCCCTGGCTTGG
GGCCGTCCTTGTCGCCAGTGCCGCAGGATGATGTCCCGAAATGTTGTGGT
TGTTCCCACTCAGGTTGCAGTTCCAGTTGCTACCAACAACAACATCACCA
CCACTACTACATTTGTACCAGTCGCTGCTGTGTCCACCCAAGCAAGCTTT
CTAGACCAT
BO26988.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:43:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-RA | 228 | CG43773-PA | 1..225 | 17..241 | 1125 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:43:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-RA | 295 | CG43773-RA | 13..238 | 16..241 | 1130 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:43:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 4007702..4007927 | 16..241 | 1130 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 07:43:03 has no hits.
BO26988.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-09-09 16:57:00 Download gff for
BO26988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10039-RB | 14..238 | 17..243 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:08 Download gff for
BO26988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 14..238 | 17..243 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:15:44 Download gff for
BO26988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43773-RA | 14..238 | 17..243 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:15:44 Download gff for
BO26988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 4007703..4007927 | 17..243 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:08 Download gff for
BO26988.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 4007703..4007927 | 17..243 | 99 | | Plus |
BO26988.pep Sequence
Translation from 16 to 259
> BO26988.pep
MSDININLKCAECNHPRGVLYYANPLAWGRPCRQCRRMMSRNVVVVPTQV
AVPVATNNNITTTTTFVPVAAVSTQASFLDH
BO26988.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:31:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43773-PA | 75 | CG43773-PA | 1..75 | 1..75 | 401 | 100 | Plus |
CG43774-PA | 95 | CG43774-PA | 4..68 | 1..68 | 215 | 62 | Plus |