BO27009.complete Sequence
163 bp assembled on 2010-07-02
GenBank Submission: KX796688
> BO27009.complete
GAAGTTATCAGTCGACATGGAAGTGGAAATGTGGTTCAAAATATCAGCAC
TTCTCAAGGCTGTAACAAAAACTGCACTCTGTTTTTATAAATACAAATAT
CCACAAATATCTGGTCTTAACATGGCAACATTTCAAGTCTTCCAAGCAAG
CTTTCTAGACCAT
BO27009.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 02:13:55 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:13:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp33A-RA | 340 | CG6555-RA | 188..316 | 17..145 | 645 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:13:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 11591363..11591491 | 145..17 | 645 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:13:54 has no hits.
BO27009.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 12:46:22 Download gff for
BO27009.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15841-RA | 188..316 | 17..147 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:14:16 Download gff for
BO27009.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG15841-RA | 188..316 | 17..147 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:24:46 Download gff for
BO27009.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp33A-RA | 188..316 | 17..147 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:24:46 Download gff for
BO27009.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 11591361..11591491 | 17..147 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:14:16 Download gff for
BO27009.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 11591361..11591491 | 17..147 | 98 | | Minus |
BO27009.pep Sequence
Translation from 16 to 163
> BO27009.pep
MEVEMWFKISALLKAVTKTALCFYKYKYPQISGLNMATFQVFQASFLDH
Sequence BO27009.pep has no blast hits.
