Clone BO27025 Report

Search the DGRC for BO27025

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:270
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptMst57Da-RA
Protein status:BO27025.pep: Imported from assembly
Sequenced Size:259

Clone Sequence Records

BO27025.complete Sequence

259 bp assembled on 2010-07-02

GenBank Submission: KX798794

> BO27025.complete
GAAGTTATCAGTCGACATGAAGTTCCTAGCTCTTTTCGTCACTTTGCTGG
TTGTTCTGGCTTTGGTTAGCGCCCAAAAGAGCCAGAATACAAATCACAAC
GTCATCGTCATCGGTGCCAAGAAGCCAGGAGCTGCACCTGCCGCAGCAGC
TGCTGCTGCTCCTGCCGCACCTCCTGCCGCAGCTCCTGCCGCAGCTCCAG
CTGCTCCTGAAGCAGGACTCGCAGATGCTCCAGCCGAAAGTGCAAGCTTT
CTAGACCAT

BO27025.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Mst57Da-RA 228 CG9074-PA 1..225 17..241 1125 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:07:20
Subject Length Description Subject Range Query Range Score Percent Strand
Mst57Da-RA 325 CG9074-RA 20..248 13..241 1130 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25831652..25831880 241..13 1130 99.6 Minus
Blast to na_te.dros performed 2014-11-28 02:07:18
Subject Length Description Subject Range Query Range Score Percent Strand
G4 3856 G4 G4_DM 3856bp 724..780 63..6 116 69 Minus

BO27025.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:51 Download gff for BO27025.complete
Subject Subject Range Query Range Percent Splice Strand
Mst57Da-RA 420..644 17..243 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:11:17 Download gff for BO27025.complete
Subject Subject Range Query Range Percent Splice Strand
Mst57Da-RA 24..248 17..243 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:13 Download gff for BO27025.complete
Subject Subject Range Query Range Percent Splice Strand
Mst57Da-RA 24..248 17..243 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:13 Download gff for BO27025.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25831650..25831876 17..243 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:11:17 Download gff for BO27025.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21657372..21657598 17..243 99   Minus

BO27025.pep Sequence

Translation from 16 to 259

> BO27025.pep
MKFLALFVTLLVVLALVSAQKSQNTNHNVIVIGAKKPGAAPAAAAAAAPA
APPAAAPAAAPAAPEAGLADAPAESASFLDH

BO27025.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:19
Subject Length Description Subject Range Query Range Score Percent Strand
Mst57Da-PA 75 CG9074-PA 1..75 1..75 360 100 Plus