BO27025.complete Sequence
259 bp assembled on 2010-07-02
GenBank Submission: KX798794
> BO27025.complete
GAAGTTATCAGTCGACATGAAGTTCCTAGCTCTTTTCGTCACTTTGCTGG
TTGTTCTGGCTTTGGTTAGCGCCCAAAAGAGCCAGAATACAAATCACAAC
GTCATCGTCATCGGTGCCAAGAAGCCAGGAGCTGCACCTGCCGCAGCAGC
TGCTGCTGCTCCTGCCGCACCTCCTGCCGCAGCTCCTGCCGCAGCTCCAG
CTGCTCCTGAAGCAGGACTCGCAGATGCTCCAGCCGAAAGTGCAAGCTTT
CTAGACCAT
BO27025.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:07:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Mst57Da-RA | 228 | CG9074-PA | 1..225 | 17..241 | 1125 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:07:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Mst57Da-RA | 325 | CG9074-RA | 20..248 | 13..241 | 1130 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:07:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 25831652..25831880 | 241..13 | 1130 | 99.6 | Minus |
Blast to na_te.dros performed 2014-11-28 02:07:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
G4 | 3856 | G4 G4_DM 3856bp | 724..780 | 63..6 | 116 | 69 | Minus |
BO27025.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-02 10:01:51 Download gff for
BO27025.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Mst57Da-RA | 420..644 | 17..243 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:11:17 Download gff for
BO27025.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Mst57Da-RA | 24..248 | 17..243 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:22:13 Download gff for
BO27025.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Mst57Da-RA | 24..248 | 17..243 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:22:13 Download gff for
BO27025.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 25831650..25831876 | 17..243 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:11:17 Download gff for
BO27025.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 21657372..21657598 | 17..243 | 99 | | Minus |
BO27025.pep Sequence
Translation from 16 to 259
> BO27025.pep
MKFLALFVTLLVVLALVSAQKSQNTNHNVIVIGAKKPGAAPAAAAAAAPA
APPAAAPAAAPAAPEAGLADAPAESASFLDH
BO27025.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:28:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Mst57Da-PA | 75 | CG9074-PA | 1..75 | 1..75 | 360 | 100 | Plus |