BO27052.complete Sequence
298 bp assembled on 2012-04-24
GenBank Submission: KX796263
> BO27052.complete
GAAGTTATCAGTCGACATGCCAAGTCATTGGCCATGTCTTTTGATCCTGC
TTGTTGTAATCGTACTCATCCTAGCTGTTTGCGGATACTACACAATTATT
CACCCGAAACAGATTCATCTGGAAAGCTGTTTTCTCAAAGGCGGGGCCTG
CCGGGAAACGTGGAACTGCGACGAAAGGTACCGCAGTCGCGTTCGCACCA
CGTGTATCAACAAACGAAAGGTCTGCTGCATGCCCACGCTCCAGATAAAG
AGCATTCAGGATGCCGAGTACTACATCGAGGCAAGCTTTCTAGACCAT
BO27052.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:47:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-RB | 267 | CG34286-PB | 1..264 | 17..280 | 1320 | 100 | Plus |
CG34286-RA | 267 | CG34286-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:47:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-RB | 686 | CG34286-RB | 95..358 | 17..280 | 1320 | 100 | Plus |
CG34286-RA | 520 | CG34286-RA | 95..358 | 17..280 | 1320 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:47:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 19715514..19715677 | 280..117 | 820 | 100 | Minus |
3R | 32079331 | 3R | 19715734..19715833 | 116..17 | 500 | 100 | Minus |
Blast to na_te.dros performed 2014-11-28 05:47:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
rooA | 7621 | rooA ROOA_LTR 7621bp | 5363..5388 | 139..114 | 103 | 88.5 | Minus |
BO27052.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-06 12:07:08 Download gff for
BO27052.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..358 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:01:39 Download gff for
BO27052.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..358 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:29 Download gff for
BO27052.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..358 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:18:33 Download gff for
BO27052.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34286-RA | 95..358 | 17..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:18:33 Download gff for
BO27052.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 19715511..19715677 | 117..282 | 98 | <- | Minus |
3R | 19715734..19715833 | 17..116 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:29 Download gff for
BO27052.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 15541233..15541399 | 117..282 | 98 | <- | Minus |
arm_3R | 15541456..15541555 | 17..116 | 100 | | Minus |
BO27052.pep Sequence
Translation from 16 to 298
> BO27052.pep
MPSHWPCLLILLVVIVLILAVCGYYTIIHPKQIHLESCFLKGGACRETWN
CDERYRSRVRTTCINKRKVCCMPTLQIKSIQDAEYYIEASFLDH
BO27052.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34286-PB | 88 | CG34286-PB | 1..88 | 1..88 | 487 | 100 | Plus |
CG34286-PA | 88 | CG34286-PA | 1..88 | 1..88 | 487 | 100 | Plus |