Clone BO27052 Report

Search the DGRC for BO27052

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:270
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG34286-RA
Protein status:BO27052.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO27052.complete Sequence

298 bp assembled on 2012-04-24

GenBank Submission: KX796263

> BO27052.complete
GAAGTTATCAGTCGACATGCCAAGTCATTGGCCATGTCTTTTGATCCTGC
TTGTTGTAATCGTACTCATCCTAGCTGTTTGCGGATACTACACAATTATT
CACCCGAAACAGATTCATCTGGAAAGCTGTTTTCTCAAAGGCGGGGCCTG
CCGGGAAACGTGGAACTGCGACGAAAGGTACCGCAGTCGCGTTCGCACCA
CGTGTATCAACAAACGAAAGGTCTGCTGCATGCCCACGCTCCAGATAAAG
AGCATTCAGGATGCCGAGTACTACATCGAGGCAAGCTTTCTAGACCAT

BO27052.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 05:47:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-RB 267 CG34286-PB 1..264 17..280 1320 100 Plus
CG34286-RA 267 CG34286-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 05:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-RB 686 CG34286-RB 95..358 17..280 1320 100 Plus
CG34286-RA 520 CG34286-RA 95..358 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 05:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19715514..19715677 280..117 820 100 Minus
3R 32079331 3R 19715734..19715833 116..17 500 100 Minus
Blast to na_te.dros performed 2014-11-28 05:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 5363..5388 139..114 103 88.5 Minus

BO27052.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-10-06 12:07:08 Download gff for BO27052.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..358 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2012-04-24 17:01:39 Download gff for BO27052.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..358 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:32:29 Download gff for BO27052.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..358 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 06:18:33 Download gff for BO27052.complete
Subject Subject Range Query Range Percent Splice Strand
CG34286-RA 95..358 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 06:18:33 Download gff for BO27052.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19715511..19715677 117..282 98 <- Minus
3R 19715734..19715833 17..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:32:29 Download gff for BO27052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15541233..15541399 117..282 98 <- Minus
arm_3R 15541456..15541555 17..116 100   Minus

BO27052.pep Sequence

Translation from 16 to 298

> BO27052.pep
MPSHWPCLLILLVVIVLILAVCGYYTIIHPKQIHLESCFLKGGACRETWN
CDERYRSRVRTTCINKRKVCCMPTLQIKSIQDAEYYIEASFLDH

BO27052.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 08:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34286-PB 88 CG34286-PB 1..88 1..88 487 100 Plus
CG34286-PA 88 CG34286-PA 1..88 1..88 487 100 Plus