Clone BO27108 Report

Search the DGRC for BO27108

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:271
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptLcp2-RA
Protein status:BO27108.pep: Imported from assembly
Sequenced Size:412

Clone Sequence Records

BO27108.complete Sequence

412 bp assembled on 2010-08-18

GenBank Submission: KX798096

> BO27108.complete
GAAGTTATCAGTCGACATGTTCAAGTTTGTGATGATTCTCGCCGTTGTGG
GAGTGGCTACCGCCCTAGCCCCAGTTTCCCGCTCCGATGATGTACACGCT
GATGTCCTTTCCCGATCGGACGACGTTCGTGCCGACGGATTCGACTCCAG
CCTGCACACCTCAAACGGAATCGAGCAGGCCGCCAGCGGTGATGCCCATG
GCAACATCCACGGCAACTTCGGCTGGATCTCACCCGAGGGCGAGCACGTT
GAGGTAAAGTACGTCGCGAATGAAAACGGATACCAGCCCTCGGGAGCCTG
GATCCCCACTCCTCCTCCAATCCCAGAGGCCATCGCCCGCGCCGTTGCCT
GGCTGGAGTCTCACCCCCCAGCACCCGAGCACCCCCGTCATCACGCAAGC
TTTCTAGACCAT

BO27108.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-RB 381 CG8697-PB 1..378 17..394 1890 100 Plus
Lcp2-RA 381 CG8697-PA 1..378 17..394 1890 100 Plus
Lcp1-RB 393 CG11650-PB 75..390 79..394 1295 94 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-RB 927 CG8697-RB 243..630 7..394 1910 99.5 Plus
Lcp2-RA 540 CG8697-RA 33..420 7..394 1910 99.5 Plus
Lcp1-RB 1065 CG11650-RB 117..432 79..394 1295 94 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:44:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8434094..8434459 394..29 1830 100 Minus
2R 25286936 2R 8430748..8431063 394..79 1295 94 Minus
Blast to na_te.dros performed on 2014-11-28 02:44:12 has no hits.

BO27108.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-08-18 15:56:36 Download gff for BO27108.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 48..420 22..396 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:20:46 Download gff for BO27108.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 48..420 22..396 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:17:22 Download gff for BO27108.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp2-RA 48..420 22..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:17:22 Download gff for BO27108.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8434092..8434462 22..396 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:20:46 Download gff for BO27108.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4321597..4321967 22..396 98   Minus

BO27108.pep Sequence

Translation from 16 to 412

> BO27108.pep
MFKFVMILAVVGVATALAPVSRSDDVHADVLSRSDDVRADGFDSSLHTSN
GIEQAASGDAHGNIHGNFGWISPEGEHVEVKYVANENGYQPSGAWIPTPP
PIPEAIARAVAWLESHPPAPEHPRHHASFLDH

BO27108.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp2-PB 126 CG8697-PB 1..126 1..126 679 100 Plus
Lcp2-PA 126 CG8697-PA 1..126 1..126 679 100 Plus
Lcp1-PB 130 CG11650-PB 1..130 1..126 624 90 Plus
Lcp1-PA 130 CG11650-PA 1..130 1..126 624 90 Plus
Lcp4-PB 112 CG2044-PB 1..109 1..117 298 48.7 Plus